KEGG   Chloroflexus sp. Y-400-fl: Chy400_1227Help
Entry
Chy400_1227       CDS       T00859                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Chy400_1227
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Chy400_1227
   00640 Propanoate metabolism
    Chy400_1227
   00660 C5-Branched dibasic acid metabolism
    Chy400_1227
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Chy400_1227
Enzymes [BR:chl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Chy400_1227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1561939..1563081)
Genome map
AA seq 380 aa AA seqDB search
MKLHEYQARDLLARFGIPVTGGGVAVTPVEARTIAAEIGGPVVVKAQVHVGGRGKAGGVK
LAQTPTEAEQVARQILGMNIKGLTVEKVLVAEAVSYKRELYLSAILDRGSKRVMMIASAE
GGVEIEEVAKTNPDAIIKIPAHPTMGLLDFQARELAFRIGLNDGKQARQFAQIASALYRA
FVECDASLVEINPLVVKADGSLLALDSKILLDESALFRHPDLAALHDPSAEPEAERRARE
AGITYIKLDGNIGCMVNGAGLAMATMDVIKLSGGEPANFLDIGGGAGKEKVKAALQIILS
DPNVKAVLFNIFGGITRVDEVARGIIAALEEVPTDVPMVARLVGTNEEAGRALLAESKLI
PAATLAEGAQKAVAAARGEL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcatgaatatcaggctcgcgacctgttagcccgttttggtattccggtgaca
ggtggcggggtagcggttacaccggtggaagcacgcaccatcgccgcagagatcggcggc
ccggtcgtggtgaaagcccaggtacatgttggtggacgtggtaaggctggtggtgtaaag
ctggcgcaaaccccaactgaggccgagcaggttgccagacagattcttggcatgaacatc
aaggggttgacggtggagaaggtattggttgccgaagcggtgagctacaagcgcgagctg
tacctttcggccatccttgatcgcggcagcaagcgcgtgatgatgattgcctcggctgaa
ggtggggttgaaattgaagaagtagcgaagacgaaccccgacgccatcattaagattccg
gcccatccaacgatgggtctgctcgattttcaggcccgggaactggcatttcgcattggc
ttaaacgatggcaagcaagcgcgtcagttcgcacaaattgccagtgctctgtatcgagct
tttgttgagtgtgatgcctcactggtggagatcaatccgttggttgtcaaggccgacggc
agcctgcttgccctcgactcgaaaattctcctcgatgagagtgcgctattccgccatccc
gatctggctgccctgcacgatccctctgccgagccggaagctgagcggcgtgcccgcgaa
gcgggtatcacctatattaagctcgatggcaacattggctgcatggtcaatggtgccggt
ctggcgatggccaccatggatgtgattaagctgtcaggtggcgagccggccaatttcctt
gatattggtggtggtgccggcaaagagaaggtcaaagccgctttacagatcattctctct
gatccaaacgtgaaggcggtgttgtttaatatctttggtgggattacgcgggtcgacgaa
gtggcacgcgggattattgctgcgctcgaagaggtgccaaccgatgtgccgatggtggcc
cggctggtggggacaaatgaagaagccggacgggcactgctggccgagtcgaagttgatc
cctgcggcaacgctggctgagggtgcgcagaaggcagtagcagccgctcgcggtgagtta
taa

DBGET integrated database retrieval system