KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_1312Help
Entry
Chy400_1312       CDS       T00859                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Pathway
chl00860  Porphyrin and chlorophyll metabolism
chl01100  Metabolic pathways
Module
chl_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Chy400_1312
Enzymes [BR:chl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Chy400_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACM52733
Position
complement(1678961..1679605)
Genome map
AA seq 214 aa AA seqDB search
MTARSRHTSIWLVRHGQTEANRHRRYLGRGDSPLTDYGRRQHAALARRLRALPFTRVIVS
PTERTRALAAAILDGRSPIPVLEDPRWREIDHGRWEGLTYREVMQRFPAEAQARWAAGID
GRPAEGESLADVANRLAPAWDEVLTQYPGERILIVTHATPIQLVICWCCGQPIAEHWRWR
VDLGSITALDTYGTTIIVRTVNAVPRLVGAGESV
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctcgttcgcgccataccagtatctggcttgttcgtcatgggcagacggaggca
aaccgccaccggcggtatctcggtcgcggtgacagcccgttgaccgattatggtcggcgt
cagcacgctgccctggcccggcggttgcgggcactgcccttcacccgcgttattgtcagc
cctacggaacgcactcgcgcgctggcggctgcgattctcgatggtcgttcacccattccg
gtactcgaagacccgcgctggcgcgagattgaccacgggcgttgggaaggcttaacctac
cgggaagtgatgcagcgattcccggctgaagcccaggcgcgctgggctgccgggattgac
gggcggcctgctgagggtgagagtctggctgatgttgccaaccggctggctccggcctgg
gacgaggtgctgacccaatatcccggtgagcgaattctgatcgtaacccacgccacccct
atccaactggtgatctgctggtgctgcgggcagccgatagccgaacactggcgctggcgg
gttgatttggggagtataacggccctcgacacctacggtacgacgatcattgtccgcacc
gttaacgcggttccgcggttggtgggtgcaggagagagcgtatga

DBGET integrated database retrieval system