KEGG   Chloroflexus sp. Y-400-fl: Chy400_1312Help
Entry
Chy400_1312       CDS       T00859                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Chy400_1312
   01230 Biosynthesis of amino acids
    Chy400_1312
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chy400_1312
  Energy metabolism
   00680 Methane metabolism
    Chy400_1312
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Chy400_1312
Enzymes [BR:chl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Chy400_1312
Exosome [BR:chl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Chy400_1312
  Exosomal proteins of melanoma cells
   Chy400_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1678961..1679605)
Genome map
AA seq 214 aa AA seqDB search
MTARSRHTSIWLVRHGQTEANRHRRYLGRGDSPLTDYGRRQHAALARRLRALPFTRVIVS
PTERTRALAAAILDGRSPIPVLEDPRWREIDHGRWEGLTYREVMQRFPAEAQARWAAGID
GRPAEGESLADVANRLAPAWDEVLTQYPGERILIVTHATPIQLVICWCCGQPIAEHWRWR
VDLGSITALDTYGTTIIVRTVNAVPRLVGAGESV
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctcgttcgcgccataccagtatctggcttgttcgtcatgggcagacggaggca
aaccgccaccggcggtatctcggtcgcggtgacagcccgttgaccgattatggtcggcgt
cagcacgctgccctggcccggcggttgcgggcactgcccttcacccgcgttattgtcagc
cctacggaacgcactcgcgcgctggcggctgcgattctcgatggtcgttcacccattccg
gtactcgaagacccgcgctggcgcgagattgaccacgggcgttgggaaggcttaacctac
cgggaagtgatgcagcgattcccggctgaagcccaggcgcgctgggctgccgggattgac
gggcggcctgctgagggtgagagtctggctgatgttgccaaccggctggctccggcctgg
gacgaggtgctgacccaatatcccggtgagcgaattctgatcgtaacccacgccacccct
atccaactggtgatctgctggtgctgcgggcagccgatagccgaacactggcgctggcgg
gttgatttggggagtataacggccctcgacacctacggtacgacgatcattgtccgcacc
gttaacgcggttccgcggttggtgggtgcaggagagagcgtatga

DBGET integrated database retrieval system