KEGG   Chloroflexus sp. Y-400-fl: Chy400_1312Help
Entry
Chy400_1312       CDS       T00859                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Chy400_1312
   01230 Biosynthesis of amino acids
    Chy400_1312
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chy400_1312
  Energy metabolism
   00680 Methane metabolism
    Chy400_1312
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Chy400_1312
Enzymes [BR:chl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Chy400_1312
Exosome [BR:chl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Chy400_1312
  Exosomal proteins of melanoma cells
   Chy400_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(1678961..1679605)
Genome map
AA seq 214 aa AA seqDB search
MTARSRHTSIWLVRHGQTEANRHRRYLGRGDSPLTDYGRRQHAALARRLRALPFTRVIVS
PTERTRALAAAILDGRSPIPVLEDPRWREIDHGRWEGLTYREVMQRFPAEAQARWAAGID
GRPAEGESLADVANRLAPAWDEVLTQYPGERILIVTHATPIQLVICWCCGQPIAEHWRWR
VDLGSITALDTYGTTIIVRTVNAVPRLVGAGESV
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctcgttcgcgccataccagtatctggcttgttcgtcatgggcagacggaggca
aaccgccaccggcggtatctcggtcgcggtgacagcccgttgaccgattatggtcggcgt
cagcacgctgccctggcccggcggttgcgggcactgcccttcacccgcgttattgtcagc
cctacggaacgcactcgcgcgctggcggctgcgattctcgatggtcgttcacccattccg
gtactcgaagacccgcgctggcgcgagattgaccacgggcgttgggaaggcttaacctac
cgggaagtgatgcagcgattcccggctgaagcccaggcgcgctgggctgccgggattgac
gggcggcctgctgagggtgagagtctggctgatgttgccaaccggctggctccggcctgg
gacgaggtgctgacccaatatcccggtgagcgaattctgatcgtaacccacgccacccct
atccaactggtgatctgctggtgctgcgggcagccgatagccgaacactggcgctggcgg
gttgatttggggagtataacggccctcgacacctacggtacgacgatcattgtccgcacc
gttaacgcggttccgcggttggtgggtgcaggagagagcgtatga

DBGET integrated database retrieval system