KEGG   Chloroflexus sp. Y-400-fl: Chy400_1375Help
Entry
Chy400_1375       CDS       T00859                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Chy400_1375
Enzymes [BR:chl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Chy400_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1754918..1755961
Genome map
AA seq 347 aa AA seqDB search
MTDDIHPFPLLAMVGQTELKTALILGLINPQVGGILLSGPYGVGKTTAVRALIDLMPFVT
REPPDADGKTIVERMRLIELPLNARLEDVVGGINERVALEQRIVRLEEGILARAHGNVLY
VDEINLLDQAVVDAILDAAAQGRTFVRRGAMVRLFPSQFVLIGSMNPEEGALRPQILDRF
GLRVWVAPVNDQRARLEIYRRARDFRNDPAGFRQAYAAQTAALAEEIMIAREILPHVTIP
PELEEQALALVQQLRIPSHRAEIALLEGARARAAADFRNVVNAEDIRRIAPLALTWRHSD
WFDRHTAGVQAEQTAINAALDALFPLAETGRRRSRRSTVRQIEEGDT
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgatattcatccgtttccactgctggcgatggtcggtcagaccgagctgaaa
acggcattaatccttggcctcatcaatccacaggtaggtggcatcctgctcagtgggcct
tacggcgttggcaaaacgacggcagtccgtgccctgatcgacctgatgccattcgttaca
cgcgaacccccggatgccgatgggaagacgatagtcgagcggatgcggctaattgaactc
ccactcaatgcccgcctcgaagacgtggtgggagggattaacgagcgggtggccctcgaa
caacgaattgtccggctggaagaggggattctggcccgcgcccacggcaacgtcttgtac
gtcgatgagatcaatctactcgaccaggccgttgtcgatgccatcctcgatgctgcggcg
cagggacggacattcgtgcggcgtggtgcgatggtgcgtctcttccccagccagtttgtg
ttaatcggctcgatgaatccggaagagggcgcactgcggccccaaatcctcgaccgtttt
ggcttgcgagtatgggtagcgccggtaaacgatcagcgtgcccggcttgaaatctaccgg
cgggcacgtgattttcgcaacgatccggcaggattccggcaggcatacgcggctcaaacg
gctgcgctggccgaagagatcatgatcgctcgtgagatacttccccacgtcacaattccg
cctgagctggaagagcaggcactggccctggtacagcagttgcgcatcccttcccatcgg
gccgagattgcgcttctcgaaggcgcacgagcacgggccgccgccgattttcgcaatgtc
gtcaacgcagaagacattcggcggattgcaccgctggcactgacgtggcggcacagcgac
tggtttgatcggcatactgccggtgtccaggctgaacaaacggccatcaatgctgcgtta
gacgcactgttcccgctcgccgaaaccggacggcggcgtagccggcgcagcacagtgcgt
cagattgaagaaggtgacacctga

DBGET integrated database retrieval system