KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_1375Help
Entry
Chy400_1375       CDS       T00859                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Pathway
chl00860  Porphyrin and chlorophyll metabolism
chl01100  Metabolic pathways
chl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Chy400_1375
Enzymes [BR:chl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Chy400_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA RuvB_N MCM AAA_22 AAA_16 Sigma54_activat AAA_3 AAA_18 AAA_29 AAA_30 AAA_28 TsaE AAA_2
Motif
Other DBs
NCBI-ProteinID: ACM52795
Position
1754918..1755961
Genome map
AA seq 347 aa AA seqDB search
MTDDIHPFPLLAMVGQTELKTALILGLINPQVGGILLSGPYGVGKTTAVRALIDLMPFVT
REPPDADGKTIVERMRLIELPLNARLEDVVGGINERVALEQRIVRLEEGILARAHGNVLY
VDEINLLDQAVVDAILDAAAQGRTFVRRGAMVRLFPSQFVLIGSMNPEEGALRPQILDRF
GLRVWVAPVNDQRARLEIYRRARDFRNDPAGFRQAYAAQTAALAEEIMIAREILPHVTIP
PELEEQALALVQQLRIPSHRAEIALLEGARARAAADFRNVVNAEDIRRIAPLALTWRHSD
WFDRHTAGVQAEQTAINAALDALFPLAETGRRRSRRSTVRQIEEGDT
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgatattcatccgtttccactgctggcgatggtcggtcagaccgagctgaaa
acggcattaatccttggcctcatcaatccacaggtaggtggcatcctgctcagtgggcct
tacggcgttggcaaaacgacggcagtccgtgccctgatcgacctgatgccattcgttaca
cgcgaacccccggatgccgatgggaagacgatagtcgagcggatgcggctaattgaactc
ccactcaatgcccgcctcgaagacgtggtgggagggattaacgagcgggtggccctcgaa
caacgaattgtccggctggaagaggggattctggcccgcgcccacggcaacgtcttgtac
gtcgatgagatcaatctactcgaccaggccgttgtcgatgccatcctcgatgctgcggcg
cagggacggacattcgtgcggcgtggtgcgatggtgcgtctcttccccagccagtttgtg
ttaatcggctcgatgaatccggaagagggcgcactgcggccccaaatcctcgaccgtttt
ggcttgcgagtatgggtagcgccggtaaacgatcagcgtgcccggcttgaaatctaccgg
cgggcacgtgattttcgcaacgatccggcaggattccggcaggcatacgcggctcaaacg
gctgcgctggccgaagagatcatgatcgctcgtgagatacttccccacgtcacaattccg
cctgagctggaagagcaggcactggccctggtacagcagttgcgcatcccttcccatcgg
gccgagattgcgcttctcgaaggcgcacgagcacgggccgccgccgattttcgcaatgtc
gtcaacgcagaagacattcggcggattgcaccgctggcactgacgtggcggcacagcgac
tggtttgatcggcatactgccggtgtccaggctgaacaaacggccatcaatgctgcgtta
gacgcactgttcccgctcgccgaaaccggacggcggcgtagccggcgcagcacagtgcgt
cagattgaagaaggtgacacctga

DBGET integrated database retrieval system