KEGG   Chloroflexus sp. Y-400-fl: Chy400_1472Help
Entry
Chy400_1472       CDS       T00859                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:chl00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:chl00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:chl00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:chl00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:chl00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1868135..1869052
Genome map
AA seq 305 aa AA seqDB search
MQIDKVKVAILGSGNIGTDLMYKLLKQPGRMELALVAGIDPASEGLARARQIGIPTATDG
IESILADPDIRIVFDATSAKAHVRHARLLRDHGRIAIDLTPAARGPYVVPPVNLGEHLEA
HNVNLITCGGQATIPLVYAVSRVTAVRYAEMVSTVASRSAGPGTRQNIDEFTFTTARGLE
AIGGAREAKAIIILNPAHPPILMRNTIYVVPEGDFDEETVRQSVAQMVADVQQYVPGYRL
KSLPVIEQRSTPWGERPVIIMLLEVEGAGDFLPTYAGNLDIMTAAARRVGELFAAHLLSK
LEVTV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcgacaaagttaaagtcgccatcctcggttccggcaatataggcaccgatttg
atgtacaaactgctgaagcagccgggcagaatggagctggcgctcgttgcaggtatcgat
ccggcctctgaagggttggcgcgcgccagacagatcggtattccgaccgcaactgacggc
attgaatcgattctggccgatcctgatattcgtatcgtatttgatgccaccagcgcgaag
gcacacgtgcgccacgccaggcttttgcgcgatcatggacgcatcgctatcgatttgaca
ccggctgcacgggggccgtatgtggttccaccggtcaatctcggtgagcatcttgaggca
cataatgtgaacctcattacctgtggcggacaggcaaccattccgctggtttatgcggtg
agcagggtaacagccgttcgctatgccgagatggtgagcaccgttgcgagtcgttcagcc
gggccaggcacacgccagaatatcgatgagtttacctttaccacagcacggggcttggaa
gccatcggcggtgcccgtgaagcgaaggcgattattattttgaacccggcgcatccaccg
attctgatgcggaataccatctacgttgtgccagagggcgattttgatgaagaaaccgtc
cgccaatcggtggcacagatggtcgctgatgtacaacagtatgttcccggctatcggtta
aagagtttgcctgtcatcgaacaacgatcaacgccgtggggtgagcgaccggtcatcatt
atgctcctggaagttgaaggtgcaggtgattttctcccaacctatgccgggaatctcgac
atcatgactgccgccgcacgacgggtgggtgaactattcgccgcacacctcttgtcgaaa
ctggaggtgaccgtatga

DBGET integrated database retrieval system