KEGG   Chloroflexus sp. Y-400-fl: Chy400_1472Help
Entry
Chy400_1472       CDS       T00859                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Chy400_1472
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Chy400_1472
   00650 Butanoate metabolism
    Chy400_1472
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Chy400_1472
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Chy400_1472
   00622 Xylene degradation
    Chy400_1472
   00621 Dioxin degradation
    Chy400_1472
Enzymes [BR:chl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Chy400_1472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1868135..1869052
Genome map
AA seq 305 aa AA seqDB search
MQIDKVKVAILGSGNIGTDLMYKLLKQPGRMELALVAGIDPASEGLARARQIGIPTATDG
IESILADPDIRIVFDATSAKAHVRHARLLRDHGRIAIDLTPAARGPYVVPPVNLGEHLEA
HNVNLITCGGQATIPLVYAVSRVTAVRYAEMVSTVASRSAGPGTRQNIDEFTFTTARGLE
AIGGAREAKAIIILNPAHPPILMRNTIYVVPEGDFDEETVRQSVAQMVADVQQYVPGYRL
KSLPVIEQRSTPWGERPVIIMLLEVEGAGDFLPTYAGNLDIMTAAARRVGELFAAHLLSK
LEVTV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcgacaaagttaaagtcgccatcctcggttccggcaatataggcaccgatttg
atgtacaaactgctgaagcagccgggcagaatggagctggcgctcgttgcaggtatcgat
ccggcctctgaagggttggcgcgcgccagacagatcggtattccgaccgcaactgacggc
attgaatcgattctggccgatcctgatattcgtatcgtatttgatgccaccagcgcgaag
gcacacgtgcgccacgccaggcttttgcgcgatcatggacgcatcgctatcgatttgaca
ccggctgcacgggggccgtatgtggttccaccggtcaatctcggtgagcatcttgaggca
cataatgtgaacctcattacctgtggcggacaggcaaccattccgctggtttatgcggtg
agcagggtaacagccgttcgctatgccgagatggtgagcaccgttgcgagtcgttcagcc
gggccaggcacacgccagaatatcgatgagtttacctttaccacagcacggggcttggaa
gccatcggcggtgcccgtgaagcgaaggcgattattattttgaacccggcgcatccaccg
attctgatgcggaataccatctacgttgtgccagagggcgattttgatgaagaaaccgtc
cgccaatcggtggcacagatggtcgctgatgtacaacagtatgttcccggctatcggtta
aagagtttgcctgtcatcgaacaacgatcaacgccgtggggtgagcgaccggtcatcatt
atgctcctggaagttgaaggtgcaggtgattttctcccaacctatgccgggaatctcgac
atcatgactgccgccgcacgacgggtgggtgaactattcgccgcacacctcttgtcgaaa
ctggaggtgaccgtatga

DBGET integrated database retrieval system