KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_1532Help
Entry
Chy400_1532       CDS       T00859                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Pathway
chl00260  Glycine, serine and threonine metabolism
chl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
chl01100  Metabolic pathways
chl01110  Biosynthesis of secondary metabolites
chl01130  Biosynthesis of antibiotics
chl01230  Biosynthesis of amino acids
Module
chl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Chy400_1532
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Chy400_1532
Enzymes [BR:chl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Chy400_1532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACM52950
Position
complement(1952795..1954156)
Genome map
AA seq 453 aa AA seqDB search
METVKYLLSEDRLPETWYNIAADLPSLPPPPLHPATGQPIGPADLAPLFPMELIKQEVST
ERAIPIPDEVRAIYRQWRPTPLFRARRLEKALDTPARIYYKYEGVSPAGSHKPNTAVAQA
YYNKQEGVRRLVTETGAGQWGSSLAFAGALFGLEVEVFMVKVSYNQKPYRRALMETYGAR
VVASPSTETAAGRAILAQDPDSTGSLGIAISEAVEVAAQRDDTRYALGSVLNHVLLHQTV
IGQEAMIQMEMAGDYPDVVVGCTGGGSNFAGIAFPFIGAKLRGERPLRVVAVEPAACPSL
TKGKYAYDYGDTAHLTPLVKMHTLGSSFVPPGIHAGGLRYHGMAPLVSHLLEIGAIEAIA
IQQLETFAAGVQFARTEGILPAPEANHAIAGVIREALRCKEEGKSEVILFNLCGHGHFDL
QAYMDYQAGRLRDYEYSDAEVAMALAGLPSVGA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtggaaacggtcaagtatctactcagtgaagatcgcctgccggagacctggtacaacatc
gctgccgatttgccatcgctgccgccgccgccattgcatccggcgacgggtcaacccatt
ggccccgccgatctggcgccactctttccgatggagctgattaagcaagaggtgagtacc
gagcgcgctatcccaattcccgatgaggtacgggccatctatcgacagtggcggccaaca
ccgctcttccgtgcgcgccggttagagaaagcccttgatacgccggctcgtatctactac
aagtacgaaggggttagccctgccggtagccacaaaccgaataccgcggtggctcaggcg
tattacaacaagcaagaaggagtccgccgcctggtcaccgaaaccggtgctggtcagtgg
gggtcttccctcgccttcgccggtgcgctcttcgggcttgaggttgaagtctttatggtg
aaggtgagctacaatcagaagccgtatcgccgggcgctgatggaaacatacggcgcacgg
gtggtggcaagccccagcaccgagacggctgccggacgggctattctggcgcaagacccc
gacagcaccgggagtcttggtattgcgatttctgaagcagtagaagttgctgcgcagcgt
gatgatacgcgctatgcgttgggtagtgtgctcaaccacgtgctgctccatcagacggtg
atcgggcaggaggcaatgatccagatggagatggccggtgattatcccgatgtggtggtt
ggctgtaccggaggtggttcaaactttgctggcatcgccttccccttcatcggtgcgaag
ctgcgcggtgaacgtccgttgcgcgtggttgccgttgaaccggcagcctgtccgtcgctg
accaaagggaagtatgcctatgactacggtgatactgctcatctgacaccgctggtcaag
atgcatacccttggcagcagctttgtgccccccggtattcacgccggtggcctacgctat
cacggcatggcaccgctggttagtcatttgcttgaaattggggcaattgaagcgattgcg
atccagcagcttgaaacctttgctgccggtgtgcagttcgcccgtaccgagggcatcttg
cctgcccctgaagcaaaccacgccattgccggtgtgatccgcgaggcgctccgctgcaag
gaagagggtaagagcgaggttattctcttcaatctctgcggccacggccatttcgatttg
caggcctacatggattatcaggcggggcggttgcgtgactacgagtattctgacgccgag
gtggcaatggcgctggccggtttgccttcagttggggcctaa

DBGET integrated database retrieval system