KEGG   Chloroflexus sp. Y-400-fl: Chy400_1540Help
Entry
Chy400_1540       CDS       T00859                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:chl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1960902..1961489
Genome map
AA seq 195 aa AA seqDB search
MIASIRGIIQSIGIDHLIVETGGVGLLIYAPRSTLNAVGQIGSETFLYTLLIVREDALTL
YGFSDPAQRNLFEQLIGVSGVGPKIALNLLSSGSPDEIQKSIAGGDIARLARVPGIGKKT
AERIVLELRGKIDLRQLSGTTPGNVSTLDRELTDILISLGYSATEAAAAIAALPGDAPPT
LEERLRLALRYFGSA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgattgcatcaatccgcggcatcattcagagcatcggtatcgaccacctgatcgtcgag
accggtggggtgggacttctcatctacgctccgcgttctactttgaatgctgttggtcag
atcggtagtgaaacattcctctacaccctgctcattgtacgtgaagacgcgctgacatta
tacggttttagcgatccagctcaacgcaacctgttcgagcagttgattggtgtcagcgga
gtaggccccaaaatcgccttaaacctgctatcgagtggctctcccgatgagatacaaaag
agtattgccggtggcgatatagcacgcctggcacgagtgccaggaatcggcaagaagact
gccgaacggattgtgctggaactccggggtaagatcgatttgcgccagctatccggcacg
actccaggcaacgtgagcactctcgaccgtgagctgaccgacatcctgatcagtctaggg
tacagcgctacagaagcagccgcagcaattgcggccctaccgggagatgccccgccaacc
ctggaagagcgcttacgactggcattacgctattttggtagtgcctga

DBGET integrated database retrieval system