KEGG   Chloroflexus sp. Y-400-fl: Chy400_1810Help
Entry
Chy400_1810       CDS       T00859                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:chl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Chy400_1810
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Chy400_1810
Enzymes [BR:chl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Chy400_1810
Two-component system [BR:chl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Chy400_1810
Bacterial motility proteins [BR:chl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Chy400_1810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2288196..2289281
Genome map
AA seq 361 aa AA seqDB search
MTNPLRVLVVDDSALMRRLLRQMLESDPTIRVVGEAGDGKTAIALTAELRPDVITLDVRM
PVLDGVETTRQIMAYHPTPILVLSAAVSGQDANISFEALAAGALEVMEKPSLTDPDSLDH
LRRVLIRRVKLIARIKVVTHLRGRRQPPPVERVSLGDTPHYVRTPRIAPGQFPVLVIGAS
TGGPKVVRQLLAGLPRTFGAAVIVVQHIAQGFGAGMAEWLAGASALPLELASEGMLLRPG
HAILAPDRADLLIKPDGTVHLSMSPLLLQRPSIDITMTAVAELYGASAAGVLLTGMGRDG
AVGMRAIRRAGGLTIAQDEASCTIFGMPRAAIELGAAELVLSPEEMIVVLSERFAGSASM
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccctctgcgcgtccttgttgtcgatgactcggcgctgatgcgtcggttgttg
cggcaaatgcttgaaagtgatccgacaatccgcgtggtcggtgaggccggtgatggtaag
acggctatcgcgcttactgctgagctgcggcctgatgtgatcaccctcgatgtacgtatg
ccggtgctcgatggagtcgagacgacgcgccagatcatggcgtaccatccaacaccgatt
ctggttctatccgcagcagtcagcggtcaagacgccaacatctcgtttgaggcgctggct
gccggtgcgcttgaggtgatggaaaagccaagcctgaccgatcctgactcgctcgatcac
ctgcggcgggtgcttatcagacgggtgaagcttattgcgcggatcaaggtcgtaactcat
ctacgcggtcgtcgccagcccccacctgtagaacgtgtctctctcggtgatacgccgcac
tatgtgcgtaccccgcgcattgcccctggtcaatttccggtgctggtaatcggcgcctcg
accggtgggccgaaagtggttcgtcagttattagccggtctaccccgtacctttggggca
gcggtcatcgtagtgcagcacattgcgcaggggttcggggccggaatggccgaatggctg
gccggcgcaagcgcacttccgctggaactcgctagcgagggaatgctgctgcgacccggt
catgctattctggcccctgatcgtgccgatctccttatcaaacctgatggcactgttcat
ctgagcatgtcaccgttgttgctccaacgcccttcgattgatattacgatgacggcagtt
gccgaactctatggagccagtgcagcaggtgtactattgaccggcatggggcgtgatggg
gcggttggcatgcgggcgattcgacgggccggtgggctgacgattgcccaggacgaagcc
agttgtaccatttttggtatgcctcgtgcggcgattgagttgggtgctgccgagctggtc
ttgtcacccgaagagatgatagtggtattgagcgagcgttttgccggatctgcgagtatg
ccatga

DBGET integrated database retrieval system