KEGG   Chloroflexus sp. Y-400-fl: Chy400_1838Help
Entry
Chy400_1838       CDS       T00859                                 

Definition
(GenBank) peptidase M42 family protein
Organism
chl  Chloroflexus sp. Y-400-fl
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
2327231..2328295
Genome map
AA seq 354 aa AA seqDB search
MELAQISFLKRLLATPGPSGDEDQAARVWRAEARTFADQVYSDVLGNSFAVLEGSGPRIL
LAGHIDEIGLMISHIDDQGFLFFSPIGGWDAQVLVGQRVRLLGKNGDVIGVIGKKPIHLL
KPDERNQATKIEQMWIDIGATSKSEASELVQVGDVGVIDAPVYELPGGRIVSRSIDNRIG
AFTVLEALRLLSQNRPNAHVAAVATTQEEITFGGATTAAFSFDPQIALVVDVTFATDHPD
SDQRQWNVVKLGGGPVLSRGSANSGRVFRRLVELAEREAIPYSVQISPRYTGTDADAIHH
VRGGIASAVISIPNRYMHSPNEMIALHDVECAVRLIAAFVHSVSNVNEFIPQDE
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgcacaaatctcctttctgaaacggctgctcgctacgcctggcccttcgggt
gacgaagatcaggcagcgcgggtatggcgggccgaagcgcgcacgtttgccgatcaggtc
tatagtgatgtgctaggcaacagctttgcggtgttggaaggcagtgggccacggattctg
ctggctggtcatatcgatgagattggcttgatgatcagccatatcgacgatcaaggcttt
ctgttctttagcccgattggtggttgggatgcgcaggttctggttggtcagcgtgtgcgc
ttgctgggcaagaacggtgacgtgataggggtgatcgggaagaagccgattcacctgctc
aagcccgacgaacgcaatcaggccacgaaaatcgaacagatgtggattgatattggggcg
acgagcaagagcgaagccagtgaactggttcaggtcggcgatgttggcgtcattgacgca
ccggtctacgagctaccgggggggcgcattgtcagtcgctctatcgacaaccggatcggt
gcctttaccgttctggaagccttgcgtctactcagccagaatcggcccaacgctcacgtg
gcggctgttgccacaactcaggaagagatcacctttggcggagcaacgacggcggcgttc
agtttcgatccacagattgcgctggtggtagatgtcacttttgctaccgaccaccccgac
tcggatcagcgccagtggaacgtggtcaaactgggtggtggcccggtgttgtcacgcggc
tcagccaacagtggtcgggtttttcggcggctggttgagctggccgagcgcgaagcgatc
ccgtacagtgtgcaaatctcgccacggtacaccggtaccgatgccgacgcgatccatcat
gtgcgaggaggtattgccagtgccgtcatctctatccccaaccgctatatgcattcgccg
aacgagatgattgcattgcacgacgtggagtgcgcagtgcgcctgatcgccgcttttgtg
cattcagtcagtaatgtgaacgaatttattccacaagatgaataa

DBGET integrated database retrieval system