KEGG   Chloroflexus sp. Y-400-fl: Chy400_1913Help
Entry
Chy400_1913       CDS       T00859                                 

Definition
aldehyde dehydrogenase
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Propanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chy400_1913
   00040 Pentose and glucuronate interconversions
    Chy400_1913
   00053 Ascorbate and aldarate metabolism
    Chy400_1913
   00620 Pyruvate metabolism
    Chy400_1913
   00640 Propanoate metabolism
    Chy400_1913
  Lipid metabolism
   00071 Fatty acid degradation
    Chy400_1913
   00561 Glycerolipid metabolism
    Chy400_1913
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Chy400_1913
   00310 Lysine degradation
    Chy400_1913
   00330 Arginine and proline metabolism
    Chy400_1913
   00340 Histidine metabolism
    Chy400_1913
   00380 Tryptophan metabolism
    Chy400_1913
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Chy400_1913
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Chy400_1913
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Chy400_1913
Enzymes [BR:chl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Chy400_1913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2417749..2419245
Genome map
AA seq 498 aa AA seqDB search
MSTPRVFHNLIGGEFVPAQSGKTFERRNPADTRDVVGIFADSDERDVHAAVEAAKAAFPQ
WSKVPAPKRGEILLRAAELLQARKEQYSRDLTREMGKPLFEAGGDIVEAIGMAQYAGSEG
RRMHGVTTPSELPNKFQMSIRQPIGVVGLITPWNFPMAIASWKMLPAIVCGNTVVIKPGE
DASVSTYNLVQCLMEAGLPPGVVNIVTGYGPRAGQPLVEHPDVPVISFTGSTETGRLVYE
LGARRIKRVSLEMGGKNPLIVMPDADLDLALDGVLWAAFGTTGQRCTATSRLIVHRAVAK
ELVERIVARAQSLRVGNGLDPATEMGPLVNEKQLQRVLNYIDIGKQEGATLLCGGYRLTG
GDYDYGYFIAPTVFTNVTSQMRIAREEIFGPVLSVIEVDSLDEAVAIANDVAYGLSSAIY
TRDINAAFRAMQALQAGIVYINAPTIGAEIHLPFGGVKATGNGHREAGPTMLDVFSEWKS
VYIDYSGALQRAQIDNAD
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
gtgtccacaccacgtgtatttcacaatttgattggcggcgaattcgtgcctgcgcagagc
ggaaagacctttgagcgtcgtaatccggcggatacccgcgacgtggtaggcatctttgcc
gatagcgatgagcgcgatgtgcacgcggctgttgaagcagccaaggcggcatttccccaa
tggagcaaggtaccggcgcctaagcgcggcgagattctgctccgggcagccgaactctta
caggcgcgcaaagagcagtacagtcgcgacctgacacgcgaaatggggaaaccgttgttt
gaagccggcggcgatattgttgaagccatcgggatggcccaatacgccggtagcgagggg
cgtcggatgcatggtgtgacgaccccttccgaattacccaacaagtttcagatgagtatc
cggcaaccgattggggtggtgggcctgattacgccgtggaacttcccgatggcaattgca
tcctggaagatgctgccggcgattgtctgtggcaacacagtggtcattaaaccgggagag
gatgcctcggtcagcacctacaatctggtgcaatgtctgatggaagccggcctgccccct
ggcgtggtcaatatcgtcaccggatacgggccacgagccgggcaaccactggttgaacat
cccgatgtgccggtgatctcgtttacgggtagcactgaaaccgggcggctggtgtacgaa
ttaggagcacgacggatcaaacgggtaagcctggagatgggtgggaagaacccgttgatc
gtgatgcctgatgccgatctcgatctggctctcgatggcgtattgtgggccgcttttggg
acgaccggccagcgctgtacggcaaccagccgtctgatcgtccatcgtgccgtggctaaa
gagctggtcgaacggattgtagctcgtgcgcaatccttgcgggtaggtaacggacttgat
ccggcaaccgaaatgggtccgctggtcaacgagaagcagttgcagcgtgtgctgaactac
attgacatcggaaagcaagagggggcaacgttgttgtgcggcggctatcgcctgaccggt
ggtgactacgattatggctacttcattgcgccaaccgtatttaccaacgtcacctcccag
atgcgaattgcccgcgaagagatcttcgggccggtactgagcgtgatcgaagttgatagt
ctcgatgaggctgttgccattgccaacgatgtcgcctacggcctcagttcggcgatctac
acccgcgacatcaacgccgcgttccgggcaatgcaggcgttgcaggccgggattgtctac
attaacgcaccaacgattggcgccgagatccatctgccttttggtggtgtcaaagccacc
ggcaatggacaccgcgaagccggcccgaccatgctcgatgtcttctccgaatggaagagt
gtgtacatcgattacagtggtgccttgcaacgggcgcagattgacaatgccgattaa

DBGET integrated database retrieval system