KEGG   Chloroflexus sp. Y-400-fl: Chy400_1913Help
Entry
Chy400_1913       CDS       T00859                                 

Definition
aldehyde dehydrogenase
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chy400_1913
   00040 Pentose and glucuronate interconversions
    Chy400_1913
   00053 Ascorbate and aldarate metabolism
    Chy400_1913
   00620 Pyruvate metabolism
    Chy400_1913
  Lipid metabolism
   00071 Fatty acid degradation
    Chy400_1913
   00561 Glycerolipid metabolism
    Chy400_1913
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Chy400_1913
   00310 Lysine degradation
    Chy400_1913
   00330 Arginine and proline metabolism
    Chy400_1913
   00340 Histidine metabolism
    Chy400_1913
   00380 Tryptophan metabolism
    Chy400_1913
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Chy400_1913
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Chy400_1913
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Chy400_1913
Enzymes [BR:chl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Chy400_1913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2417749..2419245
Genome map
AA seq 498 aa AA seqDB search
MSTPRVFHNLIGGEFVPAQSGKTFERRNPADTRDVVGIFADSDERDVHAAVEAAKAAFPQ
WSKVPAPKRGEILLRAAELLQARKEQYSRDLTREMGKPLFEAGGDIVEAIGMAQYAGSEG
RRMHGVTTPSELPNKFQMSIRQPIGVVGLITPWNFPMAIASWKMLPAIVCGNTVVIKPGE
DASVSTYNLVQCLMEAGLPPGVVNIVTGYGPRAGQPLVEHPDVPVISFTGSTETGRLVYE
LGARRIKRVSLEMGGKNPLIVMPDADLDLALDGVLWAAFGTTGQRCTATSRLIVHRAVAK
ELVERIVARAQSLRVGNGLDPATEMGPLVNEKQLQRVLNYIDIGKQEGATLLCGGYRLTG
GDYDYGYFIAPTVFTNVTSQMRIAREEIFGPVLSVIEVDSLDEAVAIANDVAYGLSSAIY
TRDINAAFRAMQALQAGIVYINAPTIGAEIHLPFGGVKATGNGHREAGPTMLDVFSEWKS
VYIDYSGALQRAQIDNAD
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
gtgtccacaccacgtgtatttcacaatttgattggcggcgaattcgtgcctgcgcagagc
ggaaagacctttgagcgtcgtaatccggcggatacccgcgacgtggtaggcatctttgcc
gatagcgatgagcgcgatgtgcacgcggctgttgaagcagccaaggcggcatttccccaa
tggagcaaggtaccggcgcctaagcgcggcgagattctgctccgggcagccgaactctta
caggcgcgcaaagagcagtacagtcgcgacctgacacgcgaaatggggaaaccgttgttt
gaagccggcggcgatattgttgaagccatcgggatggcccaatacgccggtagcgagggg
cgtcggatgcatggtgtgacgaccccttccgaattacccaacaagtttcagatgagtatc
cggcaaccgattggggtggtgggcctgattacgccgtggaacttcccgatggcaattgca
tcctggaagatgctgccggcgattgtctgtggcaacacagtggtcattaaaccgggagag
gatgcctcggtcagcacctacaatctggtgcaatgtctgatggaagccggcctgccccct
ggcgtggtcaatatcgtcaccggatacgggccacgagccgggcaaccactggttgaacat
cccgatgtgccggtgatctcgtttacgggtagcactgaaaccgggcggctggtgtacgaa
ttaggagcacgacggatcaaacgggtaagcctggagatgggtgggaagaacccgttgatc
gtgatgcctgatgccgatctcgatctggctctcgatggcgtattgtgggccgcttttggg
acgaccggccagcgctgtacggcaaccagccgtctgatcgtccatcgtgccgtggctaaa
gagctggtcgaacggattgtagctcgtgcgcaatccttgcgggtaggtaacggacttgat
ccggcaaccgaaatgggtccgctggtcaacgagaagcagttgcagcgtgtgctgaactac
attgacatcggaaagcaagagggggcaacgttgttgtgcggcggctatcgcctgaccggt
ggtgactacgattatggctacttcattgcgccaaccgtatttaccaacgtcacctcccag
atgcgaattgcccgcgaagagatcttcgggccggtactgagcgtgatcgaagttgatagt
ctcgatgaggctgttgccattgccaacgatgtcgcctacggcctcagttcggcgatctac
acccgcgacatcaacgccgcgttccgggcaatgcaggcgttgcaggccgggattgtctac
attaacgcaccaacgattggcgccgagatccatctgccttttggtggtgtcaaagccacc
ggcaatggacaccgcgaagccggcccgaccatgctcgatgtcttctccgaatggaagagt
gtgtacatcgattacagtggtgccttgcaacgggcgcagattgacaatgccgattaa

DBGET integrated database retrieval system