KEGG   Chloroflexus sp. Y-400-fl: Chy400_1913Help
Entry
Chy400_1913       CDS       T00859                                 

Definition
aldehyde dehydrogenase
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Propanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:chl00010]
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:chl00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:chl00053]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:chl00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:chl00640]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:chl00071]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:chl00561]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:chl00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:chl00310]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:chl00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:chl00340]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:chl00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:chl00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:chl00903]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:chl00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2417749..2419245
Genome map
AA seq 498 aa AA seqDB search
MSTPRVFHNLIGGEFVPAQSGKTFERRNPADTRDVVGIFADSDERDVHAAVEAAKAAFPQ
WSKVPAPKRGEILLRAAELLQARKEQYSRDLTREMGKPLFEAGGDIVEAIGMAQYAGSEG
RRMHGVTTPSELPNKFQMSIRQPIGVVGLITPWNFPMAIASWKMLPAIVCGNTVVIKPGE
DASVSTYNLVQCLMEAGLPPGVVNIVTGYGPRAGQPLVEHPDVPVISFTGSTETGRLVYE
LGARRIKRVSLEMGGKNPLIVMPDADLDLALDGVLWAAFGTTGQRCTATSRLIVHRAVAK
ELVERIVARAQSLRVGNGLDPATEMGPLVNEKQLQRVLNYIDIGKQEGATLLCGGYRLTG
GDYDYGYFIAPTVFTNVTSQMRIAREEIFGPVLSVIEVDSLDEAVAIANDVAYGLSSAIY
TRDINAAFRAMQALQAGIVYINAPTIGAEIHLPFGGVKATGNGHREAGPTMLDVFSEWKS
VYIDYSGALQRAQIDNAD
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
gtgtccacaccacgtgtatttcacaatttgattggcggcgaattcgtgcctgcgcagagc
ggaaagacctttgagcgtcgtaatccggcggatacccgcgacgtggtaggcatctttgcc
gatagcgatgagcgcgatgtgcacgcggctgttgaagcagccaaggcggcatttccccaa
tggagcaaggtaccggcgcctaagcgcggcgagattctgctccgggcagccgaactctta
caggcgcgcaaagagcagtacagtcgcgacctgacacgcgaaatggggaaaccgttgttt
gaagccggcggcgatattgttgaagccatcgggatggcccaatacgccggtagcgagggg
cgtcggatgcatggtgtgacgaccccttccgaattacccaacaagtttcagatgagtatc
cggcaaccgattggggtggtgggcctgattacgccgtggaacttcccgatggcaattgca
tcctggaagatgctgccggcgattgtctgtggcaacacagtggtcattaaaccgggagag
gatgcctcggtcagcacctacaatctggtgcaatgtctgatggaagccggcctgccccct
ggcgtggtcaatatcgtcaccggatacgggccacgagccgggcaaccactggttgaacat
cccgatgtgccggtgatctcgtttacgggtagcactgaaaccgggcggctggtgtacgaa
ttaggagcacgacggatcaaacgggtaagcctggagatgggtgggaagaacccgttgatc
gtgatgcctgatgccgatctcgatctggctctcgatggcgtattgtgggccgcttttggg
acgaccggccagcgctgtacggcaaccagccgtctgatcgtccatcgtgccgtggctaaa
gagctggtcgaacggattgtagctcgtgcgcaatccttgcgggtaggtaacggacttgat
ccggcaaccgaaatgggtccgctggtcaacgagaagcagttgcagcgtgtgctgaactac
attgacatcggaaagcaagagggggcaacgttgttgtgcggcggctatcgcctgaccggt
ggtgactacgattatggctacttcattgcgccaaccgtatttaccaacgtcacctcccag
atgcgaattgcccgcgaagagatcttcgggccggtactgagcgtgatcgaagttgatagt
ctcgatgaggctgttgccattgccaacgatgtcgcctacggcctcagttcggcgatctac
acccgcgacatcaacgccgcgttccgggcaatgcaggcgttgcaggccgggattgtctac
attaacgcaccaacgattggcgccgagatccatctgccttttggtggtgtcaaagccacc
ggcaatggacaccgcgaagccggcccgaccatgctcgatgtcttctccgaatggaagagt
gtgtacatcgattacagtggtgccttgcaacgggcgcagattgacaatgccgattaa

DBGET integrated database retrieval system