KEGG   Chloroflexus sp. Y-400-fl: Chy400_2043Help
Entry
Chy400_2043       CDS       T00859                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:chl00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:chl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2590425..2591351
Genome map
AA seq 308 aa AA seqDB search
MTELRRHAIDLDNFSATEIEEILETAESMREVLSREIKQVPALRGKTVVNMFFEESTRTR
ISFELAARALSANVVAFTARGSSVEKGESLVDTVRTLQALGADIIVMRHSQSGAPYLVAR
HFRGSLINAGDGRHAHPTQALLDLYTMQSRLGQIRDLHVVIVGDILHSRVVRSNLWGLTR
LGARVTLCGPPTLIGPAAFWTATWPQVRIAYELDPLLPEADVVMALRLQKERMQSGLLPA
LREYTRIYGLTSERLARLPSHAIVMHPGPMNEGIEIFPEVATASPAVIEEQVTNGVAVRM
ALLYRMAG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgactgaattacgtcgtcatgcaatcgatctcgataactttagtgcgactgagatcgag
gagattctggaaacggctgagagtatgcgcgaggtgctgagccgtgaaattaagcaggta
ccggcactacgcggtaaaactgtggtcaatatgttttttgaggagagtacgcgcacgcgc
atctcgtttgagctggcagcgcgggctttgtcggcaaatgtggtcgcctttaccgcacgg
gggagcagtgtcgagaagggtgagtcgctggttgatacggtgcgcacgctgcaagcgttg
ggtgccgacatcattgttatgcgccacagtcagtcgggtgcgccttatctggtggcgcgt
cactttcgtggctcgcttatcaatgccggcgatggccgccatgcccatcctacgcaggca
ctgctcgatctctatacgatgcagagtcgattgggacaaatccgcgatctgcacgtcgtt
attgtcggcgatattctgcatagccgggtggtgcgctccaacttgtggggcttgacccgt
ctcggtgcgcgggtgacgctctgtggccctcccaccctgatcggcccggcggcgttctgg
acggcgacctggccgcaggtgcggattgcgtatgaactcgacccactgctgccggaagcg
gatgtggtgatggcgttgcgtctgcaaaaagaacggatgcaaagcggattgctgccggcg
ttgcgcgagtacactcggatctatggcctcaccagcgaacgcctggcccgcctgccgtca
catgcgattgtgatgcatcccggcccgatgaatgaagggatcgaaatctttcccgaagtg
gctaccgcatcaccggcagtgattgaagagcaggtcaccaatggcgtcgcagtgcggatg
gcgttactctatcgaatggccggttga

DBGET integrated database retrieval system