KEGG   Chloroflexus sp. Y-400-fl: Chy400_2170Help
Entry
Chy400_2170       CDS       T00859                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:chl01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:chl01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2749308..2750192)
Genome map
AA seq 294 aa AA seqDB search
MARTVPATEPKLEKSPLEKFVVLLIVVLPFLGTIYAMVMLWQQYVDWLDVTLMLVLYVIS
GLGITIGFHRMLTHKSFETSRPLKALFLIMGCMALEGDPTSWASTHIQHHAHSDDEDDPH
SPLEGLWHSHVGWLFTHKNNIEMYGKWLTKDPTVVWVTKTWYVWAALGIIIPTLIAGWSG
LIWGGLVRIFLTHHITWSVNSICHTFGRRDYNTRDASRNNFIVGLLAFGEGWHNNHHAFP
RSAFHGLQWWQVDISAYIIRALEKVGLVWNVHRVKPEDLRKRQRTPALHEVMGD
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaccgttccggcaaccgaaccaaagttggagaagtcgccacttgaaaagttt
gtggttctgctgattgtcgttttaccgtttctgggcactatttatgcgatggtcatgctc
tggcagcaatatgtggactggctcgacgtgacgttgatgctggtgctgtacgtgatttct
ggtctgggcattaccatcggcttccaccgcatgctcacccacaagagttttgaaaccagc
cgcccactcaaggccctctttttgattatgggatgtatggccctggaaggtgatcccaca
tcgtgggcttccacccatattcaacaccatgcccactctgacgacgaagatgatccgcat
agcccgcttgagggtctctggcattcgcatgtcggctggctcttcacccacaagaacaat
atcgaaatgtatggcaaatggctcaccaaggatccgacagtggtctgggtaaccaagacg
tggtacgtgtgggcagccctcggcattattattccaaccctgatcgccggttggagcggt
ttaatctggggtggtctggtacgtatcttcctgacccaccacattacctggagcgtcaat
tcgatttgtcataccttcggtcgccgcgactacaacacacgcgatgccagccgcaacaac
ttcatcgttgggctgctcgccttcggtgaaggctggcacaacaatcatcacgccttcccc
cgctcggccttccacggtctgcaatggtggcaggttgacatctcggcctatatcattcgg
gcactagagaaggttgggctggtgtggaacgtgcaccgtgtgaagccagaggatttgcgt
aagcgccagcgcaccccggctctgcacgaagtgatgggtgactga

DBGET integrated database retrieval system