KEGG   Chloroflexus sp. Y-400-fl: Chy400_2737Help
Entry
Chy400_2737       CDS       T00859                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:chl00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:chl00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:chl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3374213..3375787
Genome map
AA seq 524 aa AA seqDB search
MLNKKRVLGLIVTLALLVATVSVTVAGTGIPELRRSSPTGNVIFLHPDGAGLNHWAAARI
YWYGPDALSPWDTLPQMAAYRGHMADILTGTSNGGATTHAFGYKVEGLGSFGKDGDGDSA
RSILALSGYPGSIVREAINNGHPVALVNDGDIAEPGTGAFVSEVGNRNEDNEIVGQIIDG
RPGFEGEHPPHIILAGGERFFLPQGTPPCTPDNINLDCYVHTDPITGAGPARTDGRNLLR
EFEAKGYVIVRTRAEFEALRERVNSDRRYAPYVLGLFAADDIFNDVPEERLIAAGLVDPA
IDVNDKRTNLILFGSAPGTLGYNPPTVAEMADLALTIIQRCARQAGKPFIMVAEVESVDN
FGNNDNAIGTLTGLKHANDLIQVTQNFQQRHRRTLILTAADSDAGGMQVGAWDPTRNVSD
YNNNPTGNSAQNVRSPLDGRYGRNSPPFLSEPDAYGNRMAFAVSWVGTPDVSGGIISRAQ
GLNAIEMSRTFSGRFDNTDVYRLMYLTLFGRGLPSSVGQTAPSR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacaagaaacgagtcctcggcctgattgtcaccctcgccctactggtggcaacg
gtttcagtgactgttgccggaacgggaattcccgaattacgccgttcctcaccgaccggt
aatgtgatcttccttcaccccgatggggcgggtttgaatcactgggcggctgcacgtatc
tactggtacggtcctgacgccctcagcccgtgggatacgctgccgcaaatggccgcctac
cgcggtcacatggcggatattttgaccgggacatcgaacggtggcgctaccacgcacgcc
tttggttacaaggttgaaggacttggttctttcggtaaagatggtgatggtgatagcgcc
cgcagtattcttgccctctctggctacccgggtagcattgtacgtgaggctattaacaat
ggccatcctgttgccctggtcaacgacggcgatatagccgaaccaggtactggtgcgttt
gtttctgaagtcggtaaccgtaacgaggacaacgagattgttggccagataattgatggc
cggcccggttttgagggtgagcatccgccacacatcattctggccggtggtgaacgcttc
ttcttaccgcaaggtacgccaccctgcacgcccgacaacattaatctggattgctacgtt
cacaccgatccgatcaccggtgccgggcctgctcgtaccgatggtcggaatctgttgcgt
gagtttgaagcaaagggctacgtgatcgtccgtactcgtgccgagtttgaagccctgcgt
gagcgggtcaacagtgatcgtcgctacgcaccatacgtgttgggtctcttcgctgccgac
gacatctttaacgatgtgccggaagagcgtctgattgccgccggtctggtcgatcctgcg
attgacgtcaatgataagcggaccaatctcatccttttcggcagcgctcccggtacatta
gggtacaatccgccgactgttgccgagatggccgatctggcgcttacgatcatacaacgc
tgtgcccggcaggccggtaagcccttcattatggttgccgaggtggagagtgtcgataac
tttgggaacaacgacaacgcgattggtacgctgaccggtctgaagcatgccaacgacctg
atccaggttacgcaaaacttccaacagcggcatcgacgaacgctgattctgaccgcagcc
gacagcgatgctggtggtatgcaagttggggcctgggatccaacccgcaacgtcagcgat
tacaataacaatcccacaggcaacagtgcgcagaatgtgcgatcaccgcttgatggccgc
tatggccgcaactcgcctccattcctgagtgagcctgacgcttacggcaatcgtatggca
ttcgccgtaagctgggttggcacgcctgatgtgtcgggtggcattatctctcgtgcgcag
ggtttgaacgcaattgagatgtcgcgcacgtttagcggacggttcgacaatactgacgtg
tatcggttgatgtatctgacgctgtttggtcggggattgccatcatctgttggtcagaca
gctccgtctcgctag

DBGET integrated database retrieval system