KEGG   Chloroflexus sp. Y-400-fl: Chy400_2804Help
Entry
Chy400_2804       CDS       T00859                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Chy400_2804
Enzymes [BR:chl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Chy400_2804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3455452..3456204
Genome map
AA seq 250 aa AA seqDB search
MSGLVGRRIAITRPAGRGDTLAARLQALGAIPLLTPLIAYMPPPDPAPLQQALNRLATGA
YHWLVVTSRQTVQVLADTTIPESTAIAAVGKATASDCRRAWGREPTVVPDTEIGSALPAI
MGQLAGKRVLLPCADIAPPTLTEALRAAGADVDRVTAYCTVAGPGLADLQRMIDDGAIDA
IVLASGSAVRQLQQLHVPTGLPPLVCIGPSTAAVCADLGLPIAGIAERPNDDALIAVLEQ
VFTPYCEVKE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagtggactggttggtcgtcgaatcgccatcacgcgcccggccggacgtggcgatacg
ctggctgcacgcttgcaggcgcttggtgcgattccacttctgacgccactgattgcctat
atgccgcctcccgatccggcaccattgcagcaggcgctcaatcgtctggctactggtgcg
tatcactggctggtcgtgaccagccggcagacggtgcaggtgttagctgacaccacaatt
cctgaatcgaccgccattgcagcggttggcaaagcgactgccagcgattgtcggcgggcc
tgggggcgcgaacctacagttgttcctgataccgagatcggcagtgccttgccggcgatc
atggggcagcttgccgggaagcgtgtcttgttgccctgcgcggatattgctccgccaact
ctcactgaagcgcttcgcgctgccggtgccgacgttgatcgggttaccgcctattgcacc
gtggccggccctggccttgccgatttgcaacgtatgatcgatgacggtgcgattgacgct
atcgtgctcgccagtggttcggcagttcgccagttgcagcagcttcacgtaccgaccggc
ttgccgccactggtctgcattggccccagcacggctgccgtttgcgctgatctagggctc
cccattgcgggtattgccgaacgtccaaacgacgatgcgctgattgctgtgcttgaacag
gtttttacaccgtattgtgaagtgaaggagtaa

DBGET integrated database retrieval system