KEGG   Chloroflexus sp. Y-400-fl: Chy400_2911Help
Entry
Chy400_2911       CDS       T00859                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:chl01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:chl00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3599498..3600805
Genome map
AA seq 435 aa AA seqDB search
MTVPIIRDIDTARAGILRRMPLDDDAATTTAVAGIIAGVRQRGDAALREYTQRFDGVDRA
TLEIPRERWAAAAADLDPALRHALLLAIGEIRRFHERQLRNSWVEFSVEGALGQLVRPLD
RVGLYVPGGAAPLPSSLIHAAVPARVAGVREIVVCSPPQRSTGEPAEVVMAAAHLAGVDR
LFAVGGAQAIAALAYGTESVPRVETIAGPGNRYVIQAMRLVYGTVGIVSLPGPTETLIIA
DHTASPRAVAADLLAQAEHVEASAILLTPDPVLAEQVQVEVERQLATLPSPNAQAARDAV
TRRGGIVIVPDLATAFMLANDYGPEHLCLLVADPWSYVGMVRNAGGIFLGEESFEVLGDY
VAGPSHIMPTEGTARYASPVNVDSFRKIISLVGLNRSGLNRIGPAAMRLAEAEGLVAHAA
AVKVRFESADTDGRE
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacggttcctatcatccgcgacattgatactgcccgtgccggtattctgcggcgtatg
ccactcgatgacgatgctgcgacgactactgccgttgccgggattattgctggcgtgcgc
caacggggcgatgccgcattacgcgagtatacgcaacgcttcgatggggtagatcgggca
acgcttgaaattccgcgtgagcggtgggctgcggcggcagccgatcttgatccggcgtta
cgtcatgccctcttgctggcaatcggcgagattcggcgttttcatgaacggcaactgcgc
aactcctgggttgaatttagcgtcgaaggagcactggggcagttggtgcggcccctggat
cgagttgggctttacgttcccggtggagcagccccgctcccgtcatcgttgatccacgct
gcggtacccgcacgggtcgccggtgtgcgcgagattgtggtctgctcgccaccacaacgc
tcgaccggtgaaccggctgaggtggtgatggcagcggcgcatctggccggagttgatcgc
ttgtttgcggttggtggcgcccaggccattgccgcgctggcctatggcaccgagagcgtt
ccacgggtggagacgatagccgggccagggaatcggtatgtcattcaggcgatgcgcctg
gtgtacggtacggtaggaatcgtcagtctgccagggccaaccgagaccctgatcatcgcc
gatcacacagccagcccgcgggcggttgcggctgatctgctggcacaggccgaacatgtc
gaggcaagtgccattttattgacccctgatccggtgctggccgaacaggtgcaggttgaa
gtcgaacgacagcttgccacattaccgtcaccaaatgcacaggctgcccgtgacgcagtg
acccggcgtggtggcatcgtgattgtgcccgacctggcaacagccttcatgctggccaat
gactacgggccagagcatctctgcctgttggtcgccgacccgtggtcgtatgtcggaatg
gtgcgcaacgcaggcggtattttcctgggcgaagagtcgtttgaagtactgggtgattat
gttgccgggccatcacacatcatgccaaccgagggcacggcgcgctatgcttcaccggtc
aacgttgatagttttcgcaagatcatctcgctggttggcctgaatcgaagtggtctcaat
cggattgggccagcagcgatgcggttagcagaagcagagggtctcgttgcgcacgctgct
gccgtcaaagttcgcttcgagtcggcagataccgatgggagggagtag

DBGET integrated database retrieval system