KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_2924Help
Entry
Chy400_2924       CDS       T00859                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Pathway
chl00260  Glycine, serine and threonine metabolism
chl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
chl01100  Metabolic pathways
chl01110  Biosynthesis of secondary metabolites
chl01130  Biosynthesis of antibiotics
chl01230  Biosynthesis of amino acids
Module
chl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Chy400_2924
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Chy400_2924
Enzymes [BR:chl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Chy400_2924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACM54311
Position
complement(3618446..3619636)
Genome map
AA seq 396 aa AA seqDB search
MHEVASRPGRFGPYGGRYVPETLMPAVSALEEAYTAAIADPAFWAELNRLHRTYTGRPTP
LSFAARLTAHCGGAQIYLKREDLAHTGAHKINNALGQGLLAKRMGKRRVIAETGAGQHGV
ATATVCALLGLECVVYMGVDDMARQQPNVFRMRLLGAEVRGVSSGSRTLKDAINEAMRDW
VTNPDSYYLLGSALGPHPYPTMVRDFQRVIGLEAREQILAETGRLPDVVVACVGGGSNAI
GIFHPFLDDHGVALRGVEAGGKGERLGEHAARFRAATPGVLQGTYSYVLQDEAGQIALTH
SVSAGLDYASIGPEHAWLHDSGRATYTAASDDEALAAFQLLARLEGIIPALESAHAVAEA
IRLAPTMRPDQIILVNLSGRGDKDIFTVAGLLGVSI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaggttgcttcacgaccgggccgtttcggtccctacggtgggcgatacgtccca
gaaacgctgatgccggcggtcagtgctctggaagaggcgtataccgcggcaatagccgat
cccgccttctgggcggagttgaaccggctccaccgcacctataccggcagacccacacca
ctaagctttgctgcccgcctgaccgcgcactgtggcggtgcgcagatttatttgaagcgt
gaagacctggcccacaccggtgcgcacaagatcaacaatgcactcggccagggcttgctg
gccaaacggatggggaaacgacgggtgattgccgagaccggtgccggtcagcatggggtt
gccacagccaccgtctgcgcgctgttggggctagagtgtgtggtctacatgggtgttgat
gatatggcgcgccagcagcccaatgtcttccgcatgcgcctgctcggtgccgaggtgcgc
ggcgtcagcagcggctcacgcaccctcaaagacgcgatcaacgaagcgatgcgcgactgg
gtcaccaatcctgacagttactacctgttgggttcggccctcggcccgcacccctaccca
acaatggtgcgcgactttcagcgggtgatcggtctggaagcgcgcgagcagattctggcc
gaaaccggacgcctgcccgatgtggtggtcgcctgtgttggcggtggatcgaatgcgatt
ggcatcttccatcccttcctggacgatcacggtgtggcgctccgcggggtagaggccggc
ggcaaaggtgaacgcctcggcgaacatgcagcccgcttccgcgccgctacgcccggtgtg
ttgcagggcacctattcctacgtcttgcaagacgaggccggccagatcgcgctcactcac
tcggtcagcgccgggcttgactacgccagcatcggccctgagcacgcctggttgcacgac
agcgggcgcgccacttataccgcggccagcgacgatgaggcgctggcggcgttccagttg
ctggctcgcctggaagggatcatcccggccctggaaagcgcccatgcggttgctgaagcc
attcgcctggcgccaacgatgcgccccgaccagatcattctggtcaatctgtcaggccgc
ggtgacaaagatatctttaccgttgccgggttgttgggggtatcaatctga

DBGET integrated database retrieval system