KEGG   Chloroflexus sp. Y-400-fl: Chy400_3014Help
Entry
Chy400_3014       CDS       T00859                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Chy400_3014
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Chy400_3014
Enzymes [BR:chl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Chy400_3014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3722394..3722867)
Genome map
AA seq 157 aa AA seqDB search
MNIYQFTVRTIDGEQQSLAVYRNKVLLIVNVASHCGLTPQYGDLESLYRRYKDRGFVVLG
FPSNQFNQEPDDEATIKSFCARTYAVTFPLFAKVEVNGPNTHPLFAYLKAQQPGLSPDGE
IKWNFTKFLVNRNGTVVRRYAPTDTVGAIERELVELL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaacatctaccaattcactgtacgaaccattgatggcgaacagcaatccctcgcggtc
tatcgcaataaggtgctcttaatcgtcaatgtagccagtcattgcgggttaacgccccag
tacggcgatcttgagtcgctctaccgacgctacaaagatcgtggctttgtcgtgctcggt
tttccgagtaatcaattcaaccaggaaccagacgatgaggcgacgattaaatccttctgc
gctcgcacgtatgcagtgacattcccgctgtttgccaaagttgaggtgaacggccccaat
actcacccgctctttgcctatctcaaggcgcagcagccaggacttagccccgatggcgag
attaagtggaatttcaccaagtttctggtaaatcggaatggcactgtcgttcggcggtat
gccccaactgatacggtcggcgccattgaacgtgaattggttgagttgttgtag

DBGET integrated database retrieval system