KEGG   Chloroflexus sp. Y-400-fl: Chy400_3043Help
Entry
Chy400_3043       CDS       T00859                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Chy400_3043
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chy400_3043
  Lipid metabolism
   00071 Fatty acid degradation
    Chy400_3043
  Amino acid metabolism
   00350 Tyrosine metabolism
    Chy400_3043
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Chy400_3043
   00626 Naphthalene degradation
    Chy400_3043
Enzymes [BR:chl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Chy400_3043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3753145..3754170
Genome map
AA seq 341 aa AA seqDB search
MKTMKAAVVHDFHQPLRIEEVPKPEPGFGEIVVKIEASGLCHTDIHAAHGDWPVKPKLPF
IPGHEGIGIVESVGAGVTNVKEGDRVAIPWLGYACGECKYCASGWETLCERQLNTGYFLD
GAHAQYAKAYAKYVGIVPAGVSALDAAPLTCAGVTTYKAVKVSGARPSELVAIFGVGGLG
HLALQYARIAGATVAAIDLLDERLQTARELGADITINASTQDPIEELKKWGGADAAICLA
VSPKAFEQAYRSLRRGGRLVFVGLPADNMIQLPIFETVLNGIHVMGSIVGTRADLAETFA
LHAAGKTRVLFETRKLDQVNEAFEEVEHGRNKAPRIVFSEF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatgaaagccgctgtggttcacgacttccatcaaccattgcgcatcgaggaa
gttcccaagccggagccgggttttggtgagattgtagtcaagatcgaggcatcgggactc
tgtcatacagatatacacgcagcgcatggtgattggccggtaaaaccaaaactcccattc
attccggggcacgaaggaataggcattgttgaaagcgtcggtgcaggggtaactaacgta
aaggaaggtgatcgtgttgcaatcccctggctggggtacgcctgtggcgagtgtaaatat
tgtgcttctggatgggagacgctttgtgagcgtcaactgaatactggctatttccttgat
ggggcgcatgctcagtatgcaaaagcgtatgcgaagtatgtgggtattgttccggctggg
gtttctgcccttgacgccgcaccgttaacctgtgctggcgttaccacgtacaaagctgtt
aaggtctccggagctcgtccctcggagctggtagctatctttggtgttggtggattaggt
catctggcattgcagtatgccagaatcgccggggccacggtagcggctattgatctcctg
gatgagcgattacagacagcacgcgaacttggtgccgatattaccatcaatgccagcacc
caggaccccattgaagaattgaagaagtggggcggtgctgatgcagccatctgtttagct
gtttcaccgaaggcttttgagcaggcttatcgatcattgcgacgtggcgggcgactggtt
ttcgttgggcttccggctgataacatgattcagttgccaatcttcgagacagtgctcaac
ggtattcatgtcatgggttcgattgttggaacccgcgccgacctggcagaaacatttgcg
ttacatgccgcgggcaagacgcgagtgctctttgagacgcgaaagctggatcaggtaaat
gaagctttcgaggaggttgagcacggacgtaataaggcgccacgaatcgtcttctccgaa
ttttaa

DBGET integrated database retrieval system