KEGG   Chloroflexus sp. Y-400-fl: Chy400_3140Help
Entry
Chy400_3140       CDS       T00859                                 

Definition
NADH-quinone oxidoreductase subunit G
Orthology
K00336  
NADH-quinone oxidoreductase subunit G [EC:1.6.5.3]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Chy400_3140
Enzymes [BR:chl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     Chy400_3140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3883165..3885876
Genome map
AA seq 903 aa AA seqDB search
MPDVTLTIDGVQVTVPAGTNIVDAARQAGIAIPVFCYHPRLKPVGMCRMCLVQVGTPKVD
PATRQPVVDANGQPVIAMMPKLQTACTTPVSPGMVVKTTTEEVKFAQRGILEFLLTSHPL
DCPVCDKGGECPLQNLTMGWGPAVSRFDYNDKVHFEKPVKLGDLIYLDRERCILCGRCVR
FQDEIADDPVLGFDNRGRNWMIISKSDPPFNSKFSGNTTDICPVGALTSSDFRFKARVWE
LQSKPVVCTLCPVGCNLSLDMRHDRLMRVMPRENVAVNDIWICDKGRYGHRFIESPDRLT
TPLVRRNGTLVPVSWDEALEFVADQLTIIRARHGGQALAGLAGPQLSNEDLYLFQKLLRE
LGSENIDTGIGGPTALPPDEIGGWLAPGPATDLSQLGAGTMVLVVGADPEEEAPLYMLRL
RGIAQRGGKLVVAGLRPTKLERSASRVVRYAPEGELAFAQGLLKAALAQGAHSPLLERLP
GWDKVRSMLDRVSLGDLAAACNLTGDELTQLAKDFLSAGQSLIVYGWEARSAGSALTEML
AALMLLSGRAGTANNGIIALLPGGNSRGAIEMGVRPDAGPGYTPRKQRGLDATGIWNAAQ
EGKVRAIWLAGVDPAAKLPAARAALEAAEFVVVQDLFLTASAEFADVVLPAASVAEREGT
YTNAERRVQRSRQACAPVGEARPDWQIVAAVAQALAMVPIGGGRNGPIPVTTESWSYIVA
ADVAAEIAAQVPGYTGVTHAALAATGTGGTWGRQFDDAFYYDGTSYTNTEGVGLVLPALV
GKGQLHLTFTGAVTRFADDRPLLLLEQVLAYDGDRHLRGSKLQSLIPPGYAAISSVDAAK
LNIHSGDRVRLISAAGELVIPARVLADLPAGIVLLPAGLADVMAADIETGPRTRVSLAKV
VME
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgccagatgtgacgcttaccattgatggagtgcaggtaactgtacctgctggtaccaat
attgttgatgctgcccgtcaggcagggattgccatcccggtcttttgttaccatccccgc
ctgaagccggtaggcatgtgtcgtatgtgtctggtgcaggttgggacgccgaaggttgat
ccggctacccgtcagccggtggtcgatgccaatggccagccggtgatcgcgatgatgcca
aagttgcagaccgcctgcacaacaccggtcagtccggggatggtcgtcaagaccaccacc
gaagaggtgaaatttgcccagcgtggcattcttgagttcctcctcacctctcacccgctc
gattgtccggtctgtgataagggtggcgaatgcccgttgcagaatctgacgatgggctgg
ggtccggccgtctcgcgcttcgactacaacgataaagtgcatttcgagaagccggtcaag
ctgggcgatctcatctatctcgaccgtgaacgctgtattctctgcggtcgttgtgtgcgt
ttccaggatgaaattgccgacgatccggtgcttggcttcgataaccgtggccgcaactgg
atgattatctcgaagtcggatccgccgttcaatagtaagttttccggtaatacgaccgat
atttgtccggtcggcgctctgaccagcagcgatttccggtttaaagctcgcgtgtgggaa
ttgcaaagcaagccggtggtctgtacgctgtgcccggttggttgtaacctgagccttgat
atgcgtcacgaccggctgatgcgggtgatgccgcgcgaaaatgtggcggtaaacgatatc
tggatctgtgataagggtcgttacggtcatcgctttattgagtcgcctgatcggcttacc
acaccgctggtgcgccgcaatggtacgctggtgccggtaagctgggacgaagcgcttgag
tttgtggccgatcagttgacaatcattcgagcgcgtcacggtgggcaggcgctggctggt
ctggccgggccacagcttagcaacgaagatttgtatctcttccaaaaactgctccgtgag
ctgggaagcgagaatattgataccggcattggtgggccgactgccctgccgcctgatgag
attggtggctggcttgctcctggtccggcaaccgatctgagtcagttgggtgccggaacg
atggtgctggtagttggtgctgatcccgaagaagaagcaccactctatatgcttcgcctg
cggggaattgcccaacgcggtggtaagctggtcgtggccggtctgcgaccaacgaaactt
gagcgctcggcgagccgggtggtgcgctacgcgccagagggagaactggccttcgctcag
gggttgctcaaggctgcgcttgcccagggggcgcactcaccgctgctcgaacgcttaccg
ggttgggataaggtgcgttcaatgctggatcgagtttcgcttggcgatctggcagcagcc
tgcaatctgaccggcgatgagttgacgcagttggctaaagattttctgtccgctggccag
agcctgattgtctacggatgggaagcgcgtagtgctggctcggctctcaccgaaatgctg
gctgcgctgatgctgctgagcgggcgtgccggcacggccaataacggcatcatcgccctg
ctgccgggtggtaacagccgtggtgccatcgagatgggtgtccgccctgatgccggtccc
ggctacactccgcgtaaacagcgtggccttgatgccaccggtatctggaacgcagctcaa
gaggggaaggtacgggcaatctggctggccggggtcgatccggcagcgaagctacctgcg
gcgcgggcagcgctcgaagcggctgaatttgtggttgtgcaagacctgttcctgacggcc
agtgctgaatttgccgatgttgtcttgccggcagccagcgtggctgaacgggaaggaacc
tataccaatgccgaacggcgagtacaacgttcgcggcaggcctgtgcaccggttggtgaa
gctcgacctgactggcagatcgtcgctgccgtggcgcaggcactggcgatggtaccgatt
ggtggcgggcgaaatggaccgattccggttacaaccgagtcctggtcatatatcgtagcc
gctgatgtcgctgctgaaattgccgctcaggtgcccggttataccggtgttacccatgct
gcgttggctgcgaccggtaccggtggtacctggggtcgccagttcgacgatgccttctac
tatgatgggacgagctacaccaataccgagggtgttggtctggtattgcctgcactggta
gggaaaggacaactccatctgacattcaccggtgccgtgacacgctttgccgatgatcgg
ccattactgctgctcgaacaggtactggcctatgacggtgatcgccatctccgtggctcg
aagctacagagtttgattccgcccggctatgctgcgatcagcagcgtggatgccgcaaag
ctgaatattcacagcggtgatcgggtacgtctgatttcggcagcgggtgaactggtgata
ccggcgcgggtattggcagacttgccggcaggtatcgttctgttgccggctggtctggcc
gacgtcatggctgctgacattgagaccgggccacggacacgggttagtctggctaaggtg
gtgatggaataa

DBGET integrated database retrieval system