KEGG   Chloroflexus sp. Y-400-fl: Chy400_3178Help
Entry
Chy400_3178       CDS       T00859                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Chy400_3178
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Chy400_3178
Enzymes [BR:chl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Chy400_3178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3939278..3940186
Genome map
AA seq 302 aa AA seqDB search
MSSGSQIAILGVPIDLGAGRRGVDMGPSAIRYAGLSRRLGELGYQVVDFGNLTVPMVETT
PPPPPDSRLRYLEPIADMCGRLARQVADIVQQGMLPLILGGDHSLTIGSASGSARQRRLG
LIWIDAHADFNDEHTTPSGNIHGMPLAVLTGRGHPTLTGFAGRIPAFDPAHVVLIAVRDL
DPLEREALRASPITVFTMHEIDRCGMATVMERALAIATTGTEGFHLSFDLDVVDPREAPG
VGTPVSSGISARESHLAMELIAESGALRSLDVVEVNPILDERNATAQLAVDLVLSALGKR
IL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtggatcacagattgcaattctcggcgttcccatcgatcttggagccggacgg
cgtggcgtcgatatggggccgagtgccattcgctacgccggtctgagccgaagactgggc
gagttgggctatcaggtggttgatttcggcaatctgacggtgccgatggtcgagacgacc
ccaccgccaccacctgattcacgcctgcgctatcttgagccgattgccgatatgtgtggg
cggctggcccggcaggtggccgatattgtccagcaggggatgctgcccctcattctgggt
ggtgaccatagtttaactatcggttccgccagtgggagtgcgcggcagcgacgacttggt
ctgatctggattgatgcccacgccgattttaacgatgaacacacgacaccgagtggcaat
attcacggcatgccgctggctgtgttaaccggacgcgggcatccgacgctcaccggtttt
gccggtcgcataccggctttcgatccggcgcacgtcgtattgattgccgtgcgcgatctc
gatccgctggagcgggaagcattgcgcgcttcgccgatcaccgtctttaccatgcacgag
attgatcgctgtgggatggcaacggtgatggagcgggcgctggcaattgccacgaccggt
actgaaggatttcatctcagttttgatctcgatgttgtcgatccgcgcgaggcgcccggt
gtgggtacaccggtaagcagtgggatttcggctcgcgaatcacatctggcgatggaactg
atcgccgagagtggtgcgctgcgtagtctggatgtggtcgaagttaatccgatcctcgat
gagcgtaacgcgactgcgcagttggccgtcgatctggttttgtcagcgttaggtaaacgt
attttgtag

DBGET integrated database retrieval system