KEGG   Chloroflexus sp. Y-400-fl: Chy400_3201Help
Entry
Chy400_3201       CDS       T00859                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Chy400_3201
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Chy400_3201
Enzymes [BR:chl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Chy400_3201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3990123..3990881)
Genome map
AA seq 252 aa AA seqDB search
MGDKVALITGAASGIGLACAERFAADGYRVVLVDLPGAAGEAAAERLGGIFAGVDLATQA
GCRQAVDAALNAYGRVDVLINNAGFQHIDAIEDFPEERWETMIAVMLTAPFRLTKYVWPG
MKANRWGRIVNIGSVHSLRASPFKSAYISAKHGLLGLTRTAALEGGPYGITVNLIAPAYV
RTPLVEKQIADQSRTRGIPEDQVIEKIMLEPAAIKRLIEPAEVAGLAAFLCSDAAGAITG
SVYEMALGWTAR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgggtgataaggttgcactcatcaccggcgccgccagtggcatcggcctggcctgcgcc
gagcgattcgctgccgacgggtatcgggttgtgctggttgatctgccgggtgccgccggc
gaagcagccgctgaacggctgggtggcatctttgccggcgttgatttagccacgcaggcc
gggtgccggcaagcggttgatgcagcgctcaatgcatatggtcgggttgacgtgctaatc
aacaatgccggctttcagcatatcgacgctatcgaagacttccctgaagagcgttgggag
acaatgattgccgtgatgctaacggcaccgttccggctcaccaaatacgtctggccgggg
atgaaagccaaccgctggggacggattgtcaatattggttcggtacatagcctgcgtgcc
tcaccgttcaaaagcgcctacatctcggccaaacatggcttactcggtctcacgcgcact
gccgcacttgagggtggcccttacggcattaccgtcaacctgatcgcaccggcatacgtc
agaacaccgctggtcgagaaacagatcgcggatcaatcgcgcacacggggcattcccgaa
gatcaggtgatcgagaaaatcatgctcgaaccagccgcgatcaagcgcctgatcgaaccg
gcggaggtggccggactggcggcatttctctgttcagatgcagcaggggcgataaccggc
tccgtgtacgaaatggcgctggggtggacggcacgttag

DBGET integrated database retrieval system