KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_3214Help
Entry
Chy400_3214       CDS       T00859                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Pathway
chl00620  Pyruvate metabolism
chl00630  Glyoxylate and dicarboxylate metabolism
chl01100  Metabolic pathways
chl01110  Biosynthesis of secondary metabolites
chl01120  Microbial metabolism in diverse environments
chl01200  Carbon metabolism
Module
chl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Chy400_3214
   00630 Glyoxylate and dicarboxylate metabolism
    Chy400_3214
Enzymes [BR:chl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Chy400_3214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase Pox_F15
Motif
Other DBs
NCBI-ProteinID: ACM54592
Position
complement(4010379..4011977)
Genome map
AA seq 532 aa AA seqDB search
MTTSRLPAGVTITAPITPAYAEILTPEALEFLATLHRRFNTRRLELLARRAERQRAIDAG
ERPDFLPETAHIRESEWTIAPIPPQIQDRRVEITGPVDRKMIINALNSGAKVFMADFEDA
NTPTWQNQVEGQINLRDALRRTITYTSPEGKHYALNNNPAILFVRPRGWHLNEKHMLVDG
EPISGAIFDFGLYFFHNAQTAIDVQGGPYFYLPKMESHLEARLWNDIFVLAQELRGIPQG
TIKATVLIETILAAFEMDEILYELRNHSAGLNCGRWDYIFSCIKKFRNDPNFCLADRALV
TMTTHFMRSYSLLAIKTCHRRGAHAMGGMAAQIPIKNDPVANEAALAKVRADKEREASDG
HDGTWVAHPGLVPVAMEVFDRLMPTPNQINRQRDDVQVTAADLLAFGPEKPITEQGMRLN
INVGIQYLGAWLAGNGCVPVFNLMEDAATAEISRAQIWQWIRSPKGVLEDGRKVTVELFR
QMLPEELHKVREILGPAYEDGRYEEAAELFDEITTDPEFVEFLTLPAYERIP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctcccggttaccggctggcgtgacgattaccgcaccgattactcccgcatac
gccgagattctcactcccgaagcactggaatttctggccacactccaccgccgcttcaat
acccgtcgtctggaactgcttgcccgccgcgctgaacgtcaacgcgcaattgatgcaggc
gagcgaccggattttctgcctgagacagcccatatccgcgagagcgagtggacgattgcc
cccatcccaccccagattcaggatcggcgcgttgagattaccggcccggttgaccgtaag
atgatcatcaatgcgctcaattcaggggcaaaggtgttcatggccgattttgaagatgcc
aatacgccaacctggcagaatcaggttgaaggccagatcaacctgcgcgatgctctgcgt
cgtaccattacatataccagccctgaaggcaagcactacgccctgaacaacaatccggcc
atcctgtttgttcgcccgcggggctggcatctcaacgaaaagcatatgctggttgatggt
gagccgatctctggtgctatcttcgacttcggtctctacttcttccacaatgcccagact
gccatcgatgtgcagggtggcccctatttctacctgcccaaaatggagagccacctcgaa
gcacggttgtggaatgacatctttgtgctggcccaggagttgcgcggcattccccaggga
actatcaaggccacggtcttgatcgaaacgattctggcggcgttcgagatggacgagatt
ctctacgaactgcgcaaccactcagccggtctgaattgtggacgctgggattatatcttc
tcgtgtatcaaaaagttccgcaacgaccccaacttctgtctggccgaccgggcactggtt
acgatgactacccacttcatgcgttcatattcactgctggcgatcaagacctgtcaccgc
cgtggcgcccacgcgatgggtggtatggcggctcagattccgattaagaacgatccggtt
gccaatgaagcagcgctggcaaaagtgcgggccgacaaggagcgtgaagcctctgacggc
cacgatggcacctgggtggcccaccccggtctggttccggtggcgatggaagtgttcgac
cggctaatgccaacgccgaaccagattaaccgtcagcgtgatgatgtgcaggtaactgct
gccgatctcctggcatttgggccggaaaaaccgatcaccgagcagggtatgcgcctgaat
atcaacgttgggatccagtacctcggcgcctggctggccggcaacggctgtgttccggtc
ttcaacctgatggaagatgccgccaccgccgagatttcgcgtgcccagatctggcaatgg
attcgcagcccgaagggtgtactggaggatggtcgcaaagtgacggtggaactcttccgg
cagatgctgcctgaagagctgcacaaggttcgtgagatactcggtcccgcctacgaagac
ggtcgctacgaagaggctgccgagctgtttgacgagattacaaccgatccagagtttgtg
gaattcctgaccttaccggcttacgaacggattccgtaa

DBGET integrated database retrieval system