KEGG   Chloroflexus sp. Y-400-fl: Chy400_3403Help
Entry
Chy400_3403       CDS       T00859                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:chl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4235919..4239704)
Genome map
AA seq 1261 aa AA seqDB search
MRFVFLCIEANNAPALRQAAASIEREYGLRLAIDYFTPSNMHSAADWEHLAAAVARADFV
FGSMLFGEEYVRPLSDILSSASCPVCMIMSSPSLIRQTRVGKFDLRPKPAAEQSAFRQWL
SQFQPKHGHGEIQRQMSLVRGLSKMLKFLPGKARDIHTYVMAHQFWAASSPENLRRLLLM
LIERYVPGYKGKLPVLDPQDIPEMGVFHPESPAPFADLETYRAWRRKQRHALHKGSVGLL
TMRPFALSGNRAHLDALIRALEARGIEARAAYSPTLDMRPTVERFFTRPARQRGQAPTAD
VDLLVNTTGFALVGGPASTDPDQASATLDQLDTPTLDLFPLVFQHIEQWRTDDRGIAPFQ
LALNVSLPELDGATDPLVVGGMQRGREEITPLLAEIDLAAERIAARVALRRTPPAERRIA
ITLFNFPPNLGNAGTAAYLDVFTSVFRLMQALHAAGYTVDLPASVDDLRRMVVEGNALLY
GTDGNVADSLPVEEYRRLFPDYVDIEPYWGPAPGELLSDGKRLHILGRRFGNVFVGLQPS
FGYERDPIRLLMSKDAAPHHGFAAYYVWLRKVFQAHAVLHFGTHGALEFMPGKQAGLSAK
CWPLRLIGALPNFYYYCVNNPSEGSIARRRGMATLISYLVPPVQQAGLYKGLRALKDSID
RYRAQPDPGLLADLRTQAEALHLVAEGEGDAYVAALSHELLQVEERMIPVGLHVLGEPPQ
TGEQIDTLNLIATFARVPGGPNQAPLEPLPVLVGRALGLDYAALTGRLRHDPAAQQQYRH
IEEICRAAITALVEHGDGRAADEALKRYVNLNPHLLAPLWNYLLDIQRRMTTEREVSSLL
RALNGGYVLPSAGNDVVRNPTVVPTGRNIHAFDPFHIPTQAAATSGTAVAHELLERIRAE
QGAYPETVAMVLWGTDNIKTEGEGIAQALALIGARAVADELGRITTVELIPLAELGRPRI
DVVLTVSGIFRDLFAAQARLIDRAIRLAATADEPPEQNFVRAHALAQAAELGLSVEAAAT
RVFSNASGSYGANVNHLVESSTWEEDGQLAEAFITRKGFALQPGGEWSESRALMERALAT
VSVTFQNIDSVENGISDIDHYYEYLGGLTKSVEKTRGVRPTTLMGEVAELVTPGASRVRS
LEQVVRLESRAKLLNPKWYEGMLKHGYEGVHEIEIRVSNTFGWSATAQAVEDWVYQGVAE
TYLLDPAMRERLASLNPHATASIAGRLLEAHNRGFWQADEETLAQLREIYADLEDRLEGV
R
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcgtgtttttatgtatcgaagcgaacaacgctcccgctctacggcaggcagcc
gcgagtatcgagcgtgagtacggattgcggctggcaattgattactttacaccgtcgaac
atgcacagcgcggctgattgggaacacctggcagccgctgtagcgcgggccgattttgtc
tttggttcgatgctcttcggcgaggagtatgtgcgcccgttgagtgatattctctcgtcg
gcgtcctgcccggtctgtatgattatgagtagcccttcgctgattcgccagacccgcgtc
ggtaagtttgatctgcgccccaaacccgcagccgagcagagtgcatttcggcagtggctg
agtcagtttcaacccaaacacgggcacggcgaaattcaacgccagatgtcgctggtgcgc
ggtctgagcaagatgctgaagtttttgcccggtaaggcgcgtgatattcacacttacgtg
atggcgcatcagttctgggccgccagctcgccggaaaatctgcgccgtctgttgttaatg
ctcatcgaacgttacgtgccgggctataaaggaaagctaccggtgctcgacccgcaggac
atcccagagatgggtgtatttcaccctgagtcgccagctcccttcgccgatctggagact
tatcgggcctggcggcgcaaacagcggcacgctttgcacaagggcagtgttggcctgctt
actatgcggccctttgcgttgtcgggaaatcgtgctcatctcgacgccctgattcgcgcc
ctcgaagcccgtggtatcgaggcgcgcgccgcatatagcccgacgctcgatatgcgacct
accgtcgaacggttcttcaccagacctgcccggcagcgagggcaggcgccgactgccgat
gtcgatctgctggtcaacacgaccggttttgctctggtcggaggaccggccagtactgat
cctgatcaggccagcgctacgcttgatcaactcgatacgccgacactcgatctcttccct
ctggtatttcaacacatcgagcagtggcgtaccgacgatcgcggcattgctccatttcaa
ctcgccctgaatgtatcgctccccgaacttgatggtgccaccgacccgctggtggtcggc
ggtatgcaacgcggacgcgaagagattacgccactcctcgccgagattgatctggccgcc
gagcgaattgccgcacgggttgccctgcggcgcacaccacctgccgagcgccggattgcc
atcacgctcttcaattttccgcctaacctgggaaatgccgggacagcggcctacctcgat
gtgttcaccagtgtctttcgcctgatgcaggcgctccacgccgccggctacacagtcgat
ctgccggcaagtgttgatgatctgcgacggatggtggtagaagggaatgctctgctctac
ggaaccgatgggaatgtcgccgattcgctgccggttgaggagtatcggcggctcttcccg
gattatgtcgatatagagccgtactgggggccggcgccgggtgagttgctgagcgacggg
aagcgtctgcacattctagggcggcgctttggcaacgtgtttgtcggtctgcaaccaagc
tttggctatgaacgcgatcccattcgtttgctcatgagcaaagacgcggcaccacaccac
ggttttgctgcgtattacgtctggttgcgcaaagtcttccaggctcacgccgtgctgcac
tttggcacgcatggtgcgctcgaatttatgccgggaaaacaggcaggtcttagtgccaaa
tgctggcctttgcgcctgatcggcgcgctccccaacttctactactactgcgtgaacaat
ccgagcgaaggcagcattgcccgtcggcgcggtatggctacactgatcagttatctggta
ccaccggtacagcaagccggtctgtacaaagggctacgtgcactcaaagatagtattgat
cggtaccgcgctcagcctgaccctggcttgcttgccgatctgcgcacgcaggccgaagcg
ctgcatctggttgccgagggtgaaggtgatgcgtatgtagctgcgctgagtcacgagcta
ttgcaggtcgaagagcggatgatcccggttgggttgcatgtgcttggcgagccgccacag
accggtgagcagatcgatacgcttaatctgatcgcaacctttgcccgtgtcccaggcggc
cccaatcaggcaccgctcgaaccgttgccggtattggtcgggcgcgcattgggactggat
tacgctgcactcaccgggcgcctgcgccacgatccggcagcgcagcaacagtatcgccat
atcgaagagatttgccgggcggcgatcactgccctggtcgagcacggtgacgggcgggcc
gccgatgaagcgttgaagcgttatgtcaatttaaatcctcacctcctcgcaccgctgtgg
aactacctgctcgatattcaacgccgcatgacgaccgagcgcgaagtgagcagtctgctc
cgtgccttgaatggcggctatgtattaccctcggccgggaatgatgtggtgcggaatcct
accgttgtgccgaccggacgcaatattcacgcctttgatccgttccatattcccactcag
gccgcagcaacttccggcacggcagtcgcccatgaactcctggaacggatacgcgccgag
cagggtgcgtaccctgaaacggtcgcgatggtgctgtggggaaccgacaacattaagacc
gagggagaagggattgcccaggcgttggcgctgatcggtgcccgtgcggttgccgatgaa
ctcggtcggatcaccactgtcgaactgataccgctggccgaactcggtcggccacgcatc
gacgttgtgctgacggtgagtggtattttccgcgatctgtttgcagcgcaggcgcgtctg
atcgaccgggcgattcgactggcagctaccgccgatgagccgcctgagcagaactttgtt
cgcgcccatgccttagcccaggctgctgaattggggttgagtgtcgaagcggcggcgaca
cgtgtcttctcgaacgcctcgggcagctacggggcaaatgtcaaccatctggtcgagagc
agtacgtgggaggaagatgggcaactggccgaagcgtttataacacgcaagggttttgcg
cttcagccgggtggtgaatggagtgagtcacgcgccctgatggagcgagcactggcaacg
gtgagtgtcaccttccagaacattgatagcgttgagaatggcattagtgacattgaccac
tactacgagtatctcggtggcctgactaagagcgttgagaagacccgtggtgtgcgtccg
acgacgttgatgggtgaagtagccgagttagtcacgccgggagccagtcgcgttcgctcg
ctggaacaggtggtacgtctggagagtcgggccaagttgctcaacccgaaatggtacgaa
gggatgctcaaacacggctacgagggtgtccacgagatcgagattcgagtgagcaatacc
ttcggctggagtgcaaccgcgcaggcggttgaagactgggtctaccagggagtggccgag
acctacctgctcgatccggcgatgcgtgagcggttagccagtctcaacccgcatgccacc
gccagcattgccggacggctcctcgaagcccataaccgtgggttctggcaagccgatgaa
gagacgctggcccagttgcgcgagatctatgccgatctcgaagatcggctggaaggggtg
cggtga

DBGET integrated database retrieval system