KEGG   Chloroflexus sp. Y-400-fl: Chy400_3434Help
Entry
Chy400_3434       CDS       T00859                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Chy400_3434
Enzymes [BR:chl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Chy400_3434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4283144..4284634
Genome map
AA seq 496 aa AA seqDB search
MSGRRVSGVLLHPSALPGSGGIGDIGDMAYRFVDWLATAKQRRWQIMPLGPTSYGDSPYA
GLSALAGNPLLISLEQLVQMGWLDEGALVGAPGSNGDWIDYGAIIPWKLTRLEWAFARFL
AHGSADQRAAFARFCDEQHAWLDTFALFAALKEAYRGAPWNRWDAALARREPTALAEARQ
RLADRIRFQQFLQWLFFSQWAALRQYANERGIQIIGDLPIFVAFDSADVWANPDIFHLDD
AGNPTVVAGVPPDYFSPTGQRWGNPLYRWDRLAERQYDWWIERFRVLLQLVDIVRIDHFR
GFAAYWEVPAMAETALEGRWVPGPGAALFEAVQDRLGSLPIIAEDLGLITPDVEALRRQL
GFPGMAVLQFAWGGDATSNYLPHNYTHDLVVYTGTHDNDTTVGWWSTLDERTRQHVRDYL
GARDDHIAWDFIRAALMSVADTAIIPMQDVLGLGSWARLNLPGRAEGNWAWRMRRDQLSF
DLAHHLAYLTGLYGRV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtcggcgggttagtggtgttctcctccatccttcggcgttaccgggcagcgga
gggattggcgatattggtgacatggcgtaccggtttgtagactggctggcaacggcgaag
cagcgacgctggcagattatgccacttgggccaaccagctatggtgactcgccgtatgcc
ggtttgtcggcactggcagggaatccgttgctcatttcacttgaacaactggtgcagatg
ggatggcttgatgagggggcgctggttggggcaccgggtagcaacggtgattggatcgac
tacggtgcgatcattccctggaagctgactcgtttagagtgggcgtttgcccgttttctt
gcgcatggtagtgcagatcagcgggcggcatttgcgcgattctgtgacgaacagcatgcg
tggctagacacatttgccctctttgcggcgctgaaggaagcctaccggggtgcgccatgg
aaccgctgggatgcggctctggcgcgacgtgaaccgacggctctggcagaggctcgtcag
cggctggcggatcgcattcgctttcagcaattcttgcaatggctctttttcagccagtgg
gctgcactgcgccagtacgcgaatgagcgtggtattcagattatcggcgatctaccgatt
tttgtagcgttcgacagtgccgatgtctgggccaatcccgatattttccatctggatgat
gcaggtaatccaaccgtcgttgccggtgtgccaccagactacttcagtcctaccggtcaa
cgctggggtaatccgctctaccgctgggatcggctggcggaacggcagtatgactggtgg
attgagcgatttcgggtgctcttgcagttggtagacattgtgcgtatcgatcacttccgt
ggctttgcagcgtattgggaagtgccggcaatggcggaaacggcgctcgaagggcgctgg
gtgcccggccctggcgcagccctctttgaagcggtacaggaccggttgggttcgttgcca
atcatcgctgaggatttgggcctgattacgcctgatgtggaagcgttacgccggcaactc
ggttttcccggcatggcagttttgcaatttgcctggggtggcgacgcgaccagtaactac
ttaccgcacaactatacccatgacctcgtggtgtacaccggtactcacgataatgatacg
acggtaggctggtggtcaacgctggatgagcgtactcgccagcacgtgcgggattatctg
ggcgcacgtgacgatcatatcgcgtgggattttattcgggcggccttgatgtcggtcgct
gatacggccattattcccatgcaagatgtgttgggattgggttcatgggcacggcttaat
ctgccgggcagagcggagggtaattgggcgtggcgcatgcgaagagaccagctcagtttc
gatctggcgcatcatctggcgtacctgaccgggttgtacgggcgggtgtag

DBGET integrated database retrieval system