KEGG   Chloroflexus sp. Y-400-fl: Chy400_3451Help
Entry
Chy400_3451       CDS       T00859                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Chy400_3451
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chy400_3451
   00052 Galactose metabolism
    Chy400_3451
   00500 Starch and sucrose metabolism
    Chy400_3451
   00520 Amino sugar and nucleotide sugar metabolism
    Chy400_3451
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Chy400_3451
   00524 Butirosin and neomycin biosynthesis
    Chy400_3451
Enzymes [BR:chl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Chy400_3451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4302815..4303795)
Genome map
AA seq 326 aa AA seqDB search
MYLAGDIGGTKTILALFDQATGPHHPVFEQTFASARYPDLETMIAEFREQHPVPIEGAAF
GVAGPVVSGRASITNLSWTIDAARLSTVLNGAPVRLLNDLEAIAQSVPILEPADLETLTA
GQAIAGGAIGVIAPGTGLGEAFLTWDGVRYRPHPSEGGHTTFAPRNQVEKDLLDYLHQRY
NHVSYERVCSGIGIPNLYAFVRDRLLQRETPAVAEQLAAASDPTPVIVQAGMATEQMCLV
CRTTLELFVDILAAEAGNLALKVLATGGVYIGGGLPPRMLPLIKRERFLQVFRDKGRFSE
LLSQVPIHVILEPKAGLLGAAAAAMS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtatctggccggtgacatcggcggcacaaagacaattctggccctctttgatcaggcg
accgggccacatcatccggtttttgaacagacatttgccagtgcgcgttatcccgattta
gagacgatgatcgctgagtttcgcgaacaacatccggttcccattgagggcgcagcgttt
ggcgtcgccgggccggtggtcagcggacgggccagtatcacgaatctgagctggacaatt
gacgctgccagattgagtacagtgttaaacggcgcaccggtacgcctgttaaacgatctg
gaagcgattgcccaatcggttccgattctcgaacctgctgatctggagacacttactgcg
gggcaagccattgctggtggcgcaattggggtcatcgcccctggtaccggtctgggtgag
gcatttctcacctgggacggggtgcgctatcgcccgcacccctctgaaggcggtcacacg
acattcgcgccccgcaatcaggttgaaaaagatctgctcgattacctgcatcaacggtac
aatcacgtcagctacgaacgtgtctgctcgggcattggcataccgaatttgtacgctttt
gtacgtgatcgactgctccaacgcgaaacgccggcggtcgccgagcaactggccgctgcc
agtgatcccacaccggtcattgtccaggccgggatggcaaccgaacagatgtgcctggta
tgccgtaccacccttgaactgttcgttgacattctggcagccgaagccggcaatctggcg
ttaaaggtactggcgaccggcggcgtatacattggcggtggtttaccaccacggatgctg
ccattgatcaagcgtgaacgattcctacaggtcttccgtgataaaggacgtttcagtgaa
ttgctgagccaggtgccgattcacgtcattctcgaaccgaaagccggtctcctcggcgcg
gcagcagcagcaatgagttga

DBGET integrated database retrieval system