KEGG   Chloroflexus sp. Y-400-fl: Chy400_3552Help
Entry
Chy400_3552       CDS       T00859                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:chl00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4425295..4426791)
Genome map
AA seq 498 aa AA seqDB search
MAKYAAAIDQGTTSTRCMIFDHSGNVICYDQKEHEQIYPRPGWVEHSPDEIWERTQSVIR
GALSKGGLSASDIVAVGITNQRETTVVWNRKTGRPVYNAIVWQDTRTDQICNELAADGGQ
DRFRPKVGLPLATYFSGPKIRWILDNVPGAREAAEAGDVVFGNIDTFLTWWLTGGPNGGV
HVTDVTNASRTMLMNLETLDWDDEILGIMGIPRQMLPKIVPSSMVYGTATGELAGVPVAG
ILGDQQAAMVGQTCFDVGEAKNTYGTGSFMLLNTGTKLVPSKSGLLTTVCYKFGDQPAVY
ALEGSIAITGALVQWLRDNLGLITSSAEVEALANLVEDNGGIYFVPAFSGLFAPYWRSDA
RGVIVGLTRYVNKGHLARAVLEATAYQTREVLDAMEQDSGVKLTALKVDGGMVYNNTLMQ
FQADILGVPVIRPKVAETTSLGAAYAAGLAVGFWSNTDEMRANWGVDHTWTPQMDEATRE
RLYRGWKKAVTRTFDWVE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtacgccgctgctatcgaccagggcacaaccagtacccgctgtatgatcttc
gaccatagcgggaatgtcatttgctacgatcagaaagaacacgagcagatttatccccgc
cccggctgggtagaacacagccctgatgagatttgggagcgtacccaaagtgtgattcgt
ggggcactaagcaaaggcggcctgagcgcaagcgatattgtcgccgtcggcattaccaat
cagcgcgagacaacggtggtctggaatcgcaaaacaggccgaccggtgtacaatgcgata
gtctggcaagacacccgcaccgaccagatttgtaatgaacttgccgccgacggcggtcag
gatcggttccgccccaaggttggcttgccactggcaacctacttctccggtcccaagatt
cgctggattctcgacaatgtgcccggcgcccgtgaggcggcggaggccggtgatgtggtg
tttggtaacatcgataccttcctgacctggtggctcaccggtgggcccaacggtggtgtc
cacgttaccgatgtgaccaacgcctcacgcacgatgttgatgaatctcgaaacccttgat
tgggatgatgagattctcggcattatggggattccgcgccagatgctgcccaagatcgta
ccctccagcatggtttacggtacggcaacaggtgaactggccggtgtgccggtggccggt
atcctgggcgatcagcaggcggctatggtcggacaaacctgcttcgatgtcggtgaggcc
aaaaatacctacggtaccggttcgtttatgctgctcaacaccggcacgaaactggttcca
tccaagagtggcctgctgaccaccgtctgttacaagttcggcgatcaacccgccgtctac
gccctcgaaggctcaatcgctatcaccggtgctctggtgcagtggctccgcgataacctc
ggtctgattacatcctcggcagaagtcgaggcgctggcaaatctggtcgaagataacggc
ggtatctacttcgtgccggccttctctggactcttcgcaccctactggcgctcggacgcc
cgtggtgtgattgtcggcctgactcgttatgtcaacaaaggccacctcgcccgcgccgtg
ctcgaagccactgcctaccagacgcgcgaggtgctcgacgcgatggagcaggactcaggc
gtcaagctgaccgccttgaaggtcgacggtggtatggtgtacaataataccctgatgcaa
ttccaggccgatattttgggtgtgcccgttattcggcccaaggttgcagagaccacatcg
ctcggtgctgcctatgcagccggtttagcagtcggcttctggtcaaataccgatgagatg
cgggccaactggggtgttgatcacacctggacaccacagatggatgaagcaacccgcgag
cggctctatcggggctggaagaaggcagttacccgtaccttcgattgggtggagtaa

DBGET integrated database retrieval system