KEGG   Chloroflexus sp. Y-400-fl: Chy400_3590Help
Entry
Chy400_3590       CDS       T00859                                 

Definition
peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:chl01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:chl00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4464115..4465203)
Genome map
AA seq 362 aa AA seqDB search
MTELRDELIRLTCDLIRFETIADRPDQLQAAIDYVADYLADVPGIQIEKSCVADKPALVV
TLQPTRSPRLMLNGHLDVVVGQPAQFVPEVRDGRIYGRGSQDMKGSIAVMMRLIRDLAQR
PNPPDVGFQFVTDEEIGGRHGTGRLRDEGWHCDFMLCLEPTDLGIMFEHKGGMWAQLRIP
GRAAHGSRPWEGDNPVYRLMQGIQAISERYPPPTGPHDWRTSVTPTEIRMGAGSRNQVPA
EALVTFDIRWTADTTPETIQADLAAAFPDAEFISVMASAGLRTDPEHQEVGRIADIVERH
IGHTPRFYREHFATDARYYSHIGIPAICLGPVGAGLHSAEEWVEIASLTSLYQIILDYID
TM
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacttcgtgatgaattgattcgtctcacctgcgacctgatccgttttgagacg
attgccgaccgtcccgatcagttacaggcggcgatagattatgtcgccgattatcttgcc
gacgttccgggcatccagatcgaaaagagctgtgtagccgacaagccggcgctggtcgtt
acgctgcaacccacgcgctcgccgcgtctgatgctcaacggacatctggatgtcgtggtt
ggacagccggcacagttcgtaccagaggtgcgtgatggccgcatctatggccgtggcagt
caggatatgaagggcagcattgccgtgatgatgcgcctgatccgcgatctggctcaacgg
cccaatccgccggatgtcggttttcaattcgtcaccgacgaagagattggtggacgccac
ggcaccggtcggttgcgcgatgaaggatggcactgcgactttatgctctgcctggaacca
accgacctggggattatgttcgagcacaaaggcgggatgtgggcacagttgcgcattccc
ggtcgagctgctcatggatcacggccctgggaaggcgataaccctgtctaccgactgatg
cagggcattcaagcgataagcgagcgctacccaccaccaactggccctcacgattggcga
acgtcggtaacaccaaccgagattcgcatgggggcaggttcgcggaatcaggtgccggca
gaggcgctggttacgtttgatattcgctggacggctgacaccacaccggagacgattcaa
gccgatctggcggcagcgtttcccgacgccgaattcatcagtgtcatggccagtgccggc
ctgcgcaccgatcccgaacaccaggaagtcgggcgcattgccgacatcgtcgaacggcat
atcggccacaccccccgtttctaccgcgaacattttgcgaccgatgcccgttactattcg
cacattggcatccctgccatctgcctcggcccggttggggccggcctgcattcggcagag
gagtgggtagagattgccagtctgacgagcctgtaccagattattctcgattatatcgac
accatgtag

DBGET integrated database retrieval system