KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_4018Help
Entry
Chy400_4018       CDS       T00859                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Pathway
chl00020  Citrate cycle (TCA cycle)
chl00310  Lysine degradation
chl01100  Metabolic pathways
chl01110  Biosynthesis of secondary metabolites
chl01120  Microbial metabolism in diverse environments
chl01130  Biosynthesis of antibiotics
chl01200  Carbon metabolism
Module
chl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
chl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Chy400_4018
  Amino acid metabolism
   00310 Lysine degradation
    Chy400_4018
Enzymes [BR:chl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Chy400_4018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACM55379
Position
complement(4963633..4964979)
Genome map
AA seq 448 aa AA seqDB search
MAYEIRVPSLGESIVEATVARWLKREGEPVAVGEPVVELETDKVNLEVAADQSGILTSIA
CPEGTTVGIGDLLGTIEAGALPKEAPVAAASTTTVAAPVAEPVAATAVNEVLATPVAQRM
AAEHAIDLRTVPGTGPGGRITKEDVMRLVSGTGPSEATAKADEARVHVSHPTPAVVERPQ
PAQPSPAPAPVAPPPPAPAPRPTPPAAPAVVSTNGDRREERQRLSRRRLTIARRLVEAQH
TAAMLTTFNEVDMSAVMALRARHKDSFKERHGVGLGFMSFFTKAVVGALKAFPMVNAEIQ
GEEVVIKYYYDIGIAVGVDEGLVVPVVRDADRKTFAQIEREIAQLAKKAREGTLSLAELQ
GGTFTITNGGVYGSLMSTPILNAPQVGILGMHKIEERPVVVGGQIVIRPMMYVALSYDHR
LIDGSTAVRFLVKVKELIEDPEALLLEG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgaaattcgcgtaccgtcactcggtgagtcgattgttgaggcgacggtagca
cgctggcttaagcgtgaaggtgaaccggttgcggttggtgaaccggtagttgaattggag
accgataaggttaatctcgaagtagccgccgatcagagcgggattctgaccagcatcgca
tgtccagaagggactacggttggtattggcgatctgctgggtacgattgaagccggggca
ttgcctaaagaagcaccggtggcggcagccagtacaacaacggtagcggcccctgtcgct
gaaccggtagctgctactgcggtcaatgaagtgctggcgacaccggttgcccagcgcatg
gctgccgaacacgctatcgatttgcgcacagttcccggcaccggccccggcgggcgcatt
actaaagaagatgttatgcggctggtgtcgggtaccgggccgagtgaagcaaccgctaaa
gcggatgaagcgcgggtccacgtcagccatccgaccccggctgtggtagagcgcccacag
cccgctcagccgtcacctgcgccagctccggttgcgccgccaccaccagcaccggcccca
cggccaacgccacctgcagccccggcagtagtcagtacgaatggtgaccgtcgtgaagaa
cgccagcgcctgagtcggcgccgtttaaccatcgctcgccggctggtggaagcgcagcac
accgcagcgatgcttaccaccttcaacgaagtggatatgagcgcggtgatggcgttgcgc
gcccgtcacaaggactcgttcaaagagcggcatggggttggtttgggctttatgtccttc
ttcaccaaagccgtggtcggagcgctcaaagcttttccgatggtaaatgccgagattcag
ggcgaagaggtcgtcatcaagtactactacgacatcggcatcgccgttggtgttgacgag
gggctggtggtgccggttgtgcgcgatgccgaccgtaagaccttcgcacagatcgagcgc
gaaatcgcccaactggcgaagaaggcacgggaaggaacgttgagtctggccgaacttcag
gggggcacattcacgatcacgaatggcggtgtctacggttcgctcatgagcacgccgatt
ctcaatgccccgcaagtaggcattctgggcatgcacaaaatcgaagagcgtccggtcgtc
gtcggcgggcagatcgtcattcgcccgatgatgtacgttgcgctgagctacgaccatcgc
ttgatcgatggcagcacagcagtgcgcttcctggtgaaagtgaaagagctgattgaagac
ccagaggcgttgctgctggaagggtag

DBGET integrated database retrieval system