KEGG   Chloroflexus sp. Y-400-fl: Chy400_4132Help
Entry
Chy400_4132       CDS       T00859                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Chy400_4132 (tpiA)
   01230 Biosynthesis of amino acids
    Chy400_4132 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chy400_4132 (tpiA)
   00051 Fructose and mannose metabolism
    Chy400_4132 (tpiA)
   00562 Inositol phosphate metabolism
    Chy400_4132 (tpiA)
Enzymes [BR:chl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Chy400_4132 (tpiA)
Exosome [BR:chl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Chy400_4132 (tpiA)
  Exosomal proteins of bladder cancer cells
   Chy400_4132 (tpiA)
  Exosomal proteins of melanoma cells
   Chy400_4132 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(5117369..5118121)
Genome map
AA seq 250 aa AA seqDB search
MRIPLIAGNWKMYKTVGEATTLVRDLLAGLGELSDREAIVCPPFTALAAVAALVADSPLG
LGAQNLYPEAQGAFTGEVSPPMLVDIGCRYVIIGHSERRQYFGESDAFVNRKLRAALAHG
LRPIVCVGESKPQRDAGQAEPIVTAQVRAALLEVPPDQMANVVIAYEPIWAIGTGDTATP
ADAQAMHAAIRATLAELYGSEIAATVRIQYGGSVKPDNIDELMAQPDIDGALVGGASLQA
ASFLRIIHYQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattccattaatcgccggcaactggaagatgtacaagacggttggcgaagcaacg
acgctggtgcgcgatttgctggccggtctcggtgaattatcggatcgcgaagctatcgtt
tgtccgcccttcaccgcactcgctgccgtggcagcgctggtcgccgatagcccgctgggg
ttgggggcgcagaatctgtaccccgaagcgcagggtgcgtttaccggtgaggtctcgccg
ccaatgctggttgatattggctgtcgttacgtcattattggtcatagcgagcgtcgtcag
tattttggcgagagtgatgcgtttgtgaatcgaaaattgcgtgccgcccttgcccatggt
ctgcgtcccattgtgtgtgttggcgagagtaagccccagcgtgacgccgggcaggccgag
ccgattgtgacggcacaggtgcgtgctgccctgcttgaggtgcctccggatcaaatggca
aacgtggtgattgcttacgagccgatctgggccattggtaccggcgatacggcaactcct
gcggatgcgcaggcgatgcatgcggcaattcgggcaactctggccgaattgtacggttct
gagattgccgcaacggtacgtatccagtacggtggcagtgtgaagccggataatatcgac
gaattgatggctcagcccgatattgatggtgcgttggttggtggtgcttcgttacaggca
gccagttttctgcggatcatccattatcagtag

DBGET integrated database retrieval system