KEGG   Chloroflexus sp. Y-400-fl: Chy400_4203Help
Entry
Chy400_4203       CDS       T00859                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Chy400_4203
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Chy400_4203
Enzymes [BR:chl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Chy400_4203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5212031..5213305)
Genome map
AA seq 424 aa AA seqDB search
MDRAAQIKQIADSWNTPRFAGIVRPYTPEDVYRLRGSVQIEYTLARMGAERLWNLLHTEP
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPANSGPQLVRNI
NNALRRADQIYHSEGRNDIYWFAPIVADAEAGFGGPLNVFEIMKAYIEAGAAGVHFEDQL
ASEKKCGHMGGKVLIPTQAAIRNLVAARLAADVMGVPTIIVARTDANAATLLTSDIDERD
RPFCTGERTSEGFYRVRAGLDQAIARGLAYAPYADMIWCETSEPNLEEARRFAEAIHAQF
PGKLLAYNCSPSFNWKKKLDDATIAAFQRELGAMGYKFQFVTLAGFHALNYSMFELARNY
RDRGMAAYSELQQAEFAAEAYGYTATRHQREVGTGYFDEVAQVIAGGEISTTALTGSTEE
EQFH
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtgccgcacagatcaagcagattgccgacagttggaacacgccgcgttttgcc
ggcattgtgcgcccctacacgccggaggatgtgtatcgtctgcggggttcggtgcagatt
gagtacaccctggcgcggatgggtgccgagcgcttgtggaacctcttgcacaccgagccg
tacatcaatgccctgggtgccctaacgggtaatcaggcaatgcagcaggtgaaagccggt
ctgaaagccatctacctgagtggctggcaggtagccgccgatgccaatctggcggggcag
atgtatcccgatcagagcctctatccggcaaattcaggcccccaactggtgcgcaacatc
aacaatgccctccgccgtgccgaccagatttatcacagcgaagggcgaaatgacatttac
tggtttgccccgattgtggccgatgccgaagccggctttggtggcccactcaatgtcttc
gagattatgaaggcgtatatcgaagccggtgcggcaggtgtacacttcgaggatcagctt
gcctccgaaaagaagtgtggtcatatgggcgggaaggtgttgatccccacccaggctgcg
attcgtaatctggtggcggctcgtctggcagccgatgtgatgggggtgccgacgatcatt
gtggcgcgcaccgacgcaaatgcggctacgttgctcaccagtgatattgatgagcgggat
cggcccttctgcaccggcgagcgcaccagcgagggcttctaccgggtgcgggcgggcctt
gatcaggcgattgcccgtggtctggcctatgccccctacgccgatatgatctggtgtgaa
acgagcgagccaaatctcgaagaggcacgccgctttgccgaggctattcacgcccaattc
cctggcaagttgctggcctacaactgttcgccatcgttcaactggaagaagaagctggac
gatgcgacgattgcggccttccagcgcgaattgggtgccatgggctacaagttccaattc
gtgaccctggccggcttccacgcgctgaactacagcatgtttgaactggcgcgcaactat
cgtgatcgggggatggctgcctacagcgaattgcaacaggcggaatttgccgcagaagcc
tacggttacacggcgacccgtcaccagcgtgaagttgggaccggttatttcgatgaggtg
gcgcaggtgattgccggtggcgagatcagcacaacggcattgaccggcagtactgaggaa
gagcagttccactag

DBGET integrated database retrieval system