KEGG   Corynebacterium halotolerans: A605_02095Help
Entry
A605_02095        CDS       T02472                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
chn  Corynebacterium halotolerans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:chn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
454747..456147
Genome map
AA seq 466 aa AA seqDB search
MKYAIIGAGLAGLTSAHEIRRADPEATIHVFEADDRIGGKLFTVPFSSGPTDMGAEAFLA
RRQDAVDFFTDLGLGEDIVAPSGMNSLVYTGAQVRPLPRGGVMGIPSSPEPVAHLVSGET
VARIDAEGSAEPIDWRVGGDANVGTLVRERYGDEVVDRVVSALLGGVYSCTADDLGVRAT
IPQLAEALDALAEEGRKVTLSAAVRRVEDSRPQPEPGAERRPVFGAFRGGYAQLYETLAE
RSGADIHLDAFVSGITRNLKGFHIQGGTDLAYDRLILATPAPTTAVLLRELAPEASTALR
SVKLASSALVGMKFDSAEGLPDNSGVLIAADEPDVRTKAFTFSSKKWPHLAERGGALVRA
SFGRFGDDGLNSVVRAEEDDLVDWALDDLQAITGFDGRAAGLSEIYVQRWFGGLPRYDET
HLGTVATVRRALADVPGLEVTGAWASGVGVPAVIADARAAAQRVLG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgccatcatcggggccgggctcgccggcctgaccagcgcccacgagatccgc
cgggcggatccggaggccaccatccacgtcttcgaggccgacgaccgcatcggcggcaaa
ctgttcaccgtgccgttttcctccgggccgaccgacatgggcgccgaggccttcctcgcc
cgtcggcaggacgcggtggacttcttcaccgacctcggcctgggcgaggacatcgtcgcc
ccctccgggatgaactccctggtctacaccggcgcgcaggtcagacccctgccgcgcggc
ggcgtgatgggcatcccctcgtccccggagccggtcgcccatctcgtcagcggggagacg
gtcgcgcgtatcgacgccgagggctccgccgagcccatcgactggcgggtcggcggcgac
gcgaacgtcggaacgctggtacgcgagcgctacggcgacgaggtggtcgaccgggtggtc
tccgcgctgctgggtggggtgtactcctgcaccgccgacgacctcggcgtccgggcgacc
atcccgcagttggccgaggcgctcgacgccctggccgaggagggccggaaggtcacgctc
tcggcggccgtcaggcgcgtggaggactcccgcccgcagccggagccgggggcggagcgc
cggccggtcttcggggccttccgcggcggctacgcccagctctacgagacactcgccgag
cggtcgggggcggacatccacctggacgcgttcgtctccggaatcacccgcaacctcaag
ggcttccacatccagggcggcaccgacctcgcctatgacaggctcatcctggccaccccg
gccccgaccaccgcggtgctgctcagggagctcgccccggaggcatccaccgccctcagg
tcggtcaagctggcctcctccgcgctggtgggcatgaagttcgactccgccgaggggcta
cccgacaactccggggtgctcatcgccgccgacgagccggacgtgcgcaccaaggccttc
accttctcctcgaagaagtggccccacctggccgagcgcggcggtgccctggtgcgcgcc
agcttcggccgcttcggcgacgacggcctgaactcggtggtccgggccgaggaggacgac
ctcgtcgactgggcgctcgacgacctgcaggccatcaccggtttcgacggccgcgccgcc
ggcctgtccgagatctacgtccagcgttggttcggtggcctgccccgttacgacgagacc
cacctgggcaccgtcgccacggtgcgcagggcgctcgccgacgtccccggcctcgaggtc
accggcgcctgggcctctggcgtgggcgtgcccgccgtcatcgccgacgcgcgggccgcg
gcgcagcgcgtgctgggctga

DBGET integrated database retrieval system