KEGG   Corynebacterium halotolerans: A605_02335Help
Entry
A605_02335        CDS       T02472                                 

Definition
kinase, PfkB family protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
chn  Corynebacterium halotolerans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:chn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A605_02335
Enzymes [BR:chn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     A605_02335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
504612..505520
Genome map
AA seq 302 aa AA seqDB search
MVDSTILVMGQIGRDLILTVEQFPGAGGSVDVGTRHEILGGKGVNQAVGMVQLGAPVTLL
GVTGADPAGEGLLRSLRDDGIGAEWVVRRGVSALLLDVVDADGERRLLEHVPDESLLGVD
DVRGAEEAFRAADTVCLQLQQPAATLLEAARLAVDAGARVVLDGAVTDPEKQGLLSAASV
VRADAHEAQLLTGVAMRDSGAAVNTARSLIDGGVEVVAFGVEGVGDIVAWDGGHRFFPFG
QGKADVTGGGDAFLAGLVVGLRAGCAPGEAGELAAACRDSAVQRLGGRPDLTGLAPTNSR
VG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacagcactatcctcgtcatggggcagatcggtcgcgatctcatcctcaccgtc
gaacagttcccgggcgcgggcggcagcgtggacgtcggcacgcgccacgagatcctgggt
ggcaagggtgtcaatcaggcggtcggcatggtgcagctgggggccccggtgacactcctg
ggggtcacgggcgcggacccggcgggcgaggggctcctccggtccctccgagacgacggc
atcggcgcggagtgggtggtccgccgcggcgtcagcgcacttctcctcgatgtggtcgac
gccgacggggagcgccgactgctcgagcacgtgccggatgagtcgctgctgggcgtcgac
gacgtgcgcggtgcggaggaggccttccgcgcggccgacaccgtctgcctgcagctgcag
cagccagccgccactctgctcgaggcggcccgcctcgccgtggacgccggcgcgcgggtc
gtcctcgacggcgcggtgaccgatccggagaaacaggggctgttgtccgccgcctcggtc
gtccgggcggacgcgcacgaggcgcagctgctcacgggcgtcgccatgagggactccggg
gccgccgtgaatacggcccggagcctcatcgacgggggcgtcgaggtcgtcgccttcggt
gtcgagggggtcggggacatcgtggcctgggacggcggacaccggttcttccccttcggg
caggggaaggccgacgtgacgggaggcggggacgccttcctcgccgggctggtggtcggg
ctgcgggcgggctgtgcgccgggggaggccggggaactcgcggcggcatgccgggactcc
gccgtccagcgtctgggtgggcgccccgacctcacgggactggcaccgacgaactcccgt
gtggggtag

DBGET integrated database retrieval system