KEGG   Corynebacterium halotolerans: A605_05270Help
Entry
A605_05270        CDS       T02472                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
chn  Corynebacterium halotolerans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    A605_05270
Enzymes [BR:chn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     A605_05270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1122715..1123287
Genome map
AA seq 190 aa AA seqDB search
MHDRQAGRLRVITGPMFAGKTEDLLHRIRGARQQGDDVVVVTHALDDRYGRRIVASHTGL
STPAHAVTDAEAVAGLALARPVDLVAVDEAQFFGIGLVPVLNRILDAGIPVDIAGLCMTF
DGGPYEPIATLMAHAEEITKLTAACEICGRDAAFHQLRHPEAHADARESSVARVGGAEMY
EARCRRHFTG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacaggcaggccggtcggctgcgggtgatcaccgggccgatgttcgcgggcaag
accgaggatctgctgcaccgcatccggggtgcgagacagcagggggacgacgtcgtcgtg
gtcacccacgccctcgacgaccgttacggacgacggatcgtggcctcccacaccgggttg
agcactcccgcccacgcggtcactgacgccgaggccgtcgccggactggccctggcccgg
ccggtggatctcgtcgccgtcgacgaggcccagttcttcggtatcggactcgtcccggtg
ctcaaccggatcctggacgcggggatcccggtcgacatcgcggggctgtgcatgaccttc
gacggtggaccctacgagccgatcgccacattgatggcgcacgcggaggagatcacgaaa
ctcacggccgcgtgcgagatctgtgggcgggacgcggccttccaccagctccggcacccc
gaggcgcacgccgacgcccgcgaatcgtccgtcgcgcgcgtcggtggggcggagatgtac
gaggcgcggtgccgccgtcacttcaccggctga

DBGET integrated database retrieval system