KEGG   Corynebacterium halotolerans: A605_09205Help
Entry
A605_09205        CDS       T02472                                 

Gene name
hisD
Definition
bifunctional histidinal dehydrogenase/histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
chn  Corynebacterium halotolerans
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:chn01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:chn00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2003672..2005000)
Genome map
AA seq 442 aa AA seqDB search
MLTVIDLRGRTPSTSELRRTLPRGGTDVNSVLPTVAPIVGDIRHRGVTAALEYGERFDHV
RPGSMKVPAEVIDRAVEALDPTVRTALEEAITRVRKVHAGQKPDTHTTELGPGATVTEVF
LPVQRVGLYVPGGKAVYPSSVIMNVVPAQAAGASSLVVASPPQADHDGWPHPTILAACGL
LGVDEVWAVGGSQAVALLAYGDDEADLEPVDMITGPGNIFVTAAKRLVQGTVGIDAEAGP
SEIAILADSTADPVYLAYDLISQAEHDDLAASVLITDSEELATRVDAEIDARYTVTRNAD
RVAGALSGRQSGIVLVDDLETGIAVTDAYAAEHLEIHTADAREVAGRIRNAGAIFVGPYS
PVPLGDYAAGSNHVLPTSGTARFSAGLSTHTFLRPVNLIEYDKPALQEIGGHVIALADAE
DLPAHGESIRARFETLPTQDEN
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgtcatcgacctgcgcggtcgaaccccgtccaccagcgagctgcgccgcacc
ctgcccaggggcggcaccgacgtcaactccgtgctgcccaccgtggcgccgatcgtcggc
gacatccggcatcgtggtgtgacggcggcactggagtacggcgagcgcttcgatcacgtg
cgtcccggatccatgaaggtgcccgccgaggtcatcgaccgcgcggtggaggccctcgac
ccgacggtgcgcaccgcgctcgaggaggccatcacccgggtacgcaaggtccacgccggg
cagaagcccgacacccacaccacggagctcggccccggcgccaccgtcaccgaggtcttc
ctgccggtccagcgcgtcggcctgtacgtgcccggcggcaaggcggtctacccctcctcg
gtgatcatgaacgtggtgcccgcccaggcggccggcgcatcctcgctggtcgtggcctcc
ccgccacaggccgaccacgacggctggccgcacccgacgatcctggccgcctgcgggctg
ctgggcgtcgacgaggtgtgggccgtcggcggctcccaggccgtcgcgctgctggcctac
ggcgacgacgaggcggatctggagccggtcgacatgatcaccggcccgggcaacatcttc
gtcaccgccgccaagcgcctggtgcagggcaccgtcggcatcgacgccgaggccggcccc
tccgagatcgccatcctcgccgattccaccgccgaccccgtctacctcgcctacgacctg
atcagccaggccgagcacgacgacctggccgccagtgtgctcatcaccgactccgaggag
ctggcgacccgcgtcgacgccgagatcgacgcccgctacaccgtcacccgcaacgccgac
cgcgtcgccggcgccctgtccggtagacagtccggcatcgtgctcgtcgacgacctggag
accggcatcgccgtgacggacgcctacgccgccgagcacctggagatccacaccgccgac
gcgcgtgaggtcgccgggcgcatccgcaacgccggcgccatcttcgtcggcccgtactcg
ccggtgccgctgggcgactacgccgccggctccaaccacgtcctgccgacctccggcacg
gcgcggttctccgccggactgtccacccacaccttcctgcggcccgtcaatctcatcgag
tacgacaagcccgccctgcaggagatcggcgggcacgtcatcgccctggccgacgccgag
gacctgcccgcccacggcgagtccatccgcgcccgcttcgagaccctcccgacccaggac
gagaactga

DBGET integrated database retrieval system