KEGG   Corynebacterium halotolerans: A605_10280Help
Entry
A605_10280        CDS       T02472                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
chn  Corynebacterium halotolerans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:chn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A605_10280
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A605_10280
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A605_10280
Enzymes [BR:chn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     A605_10280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2258817..2260325
Genome map
AA seq 502 aa AA seqDB search
MLWTRVTPSADAVPGSGLGAATTIKWEVALDAGFRDVVKQGEAVASADRDHTVHVDPWDL
AADTVYFYRFAVVDGEFAGHVSPTGRTRTAPDFDASPEQLNLAVASCANWESGFFSAYTD
IANRAQAGDLDLLVFLGDYIYEYGTGEAAGPHGPFRIHEPAWETVTLQDYRMRHGRYRTD
PELQAAHTALPWVVVWDDHETADNSWRGGAQNHSPAEGDWLTRRNAALRAYFEWLPVRAT
SPSEEGHIYRSLRFGDLVELTMMDLRTYRDQQARWAVGAIGDEGRTMMGSEQFEWLRRKI
ETSSAHWNVMGSSVMVAPLNLITLQQNEQTSSVADFLGSHASGVPLNPDQWDGYTADRVR
LLDVLEAHGSNVLFLSGDIHTEWANSLWHGGREIGVELVCSSVSAPNVDEQLGLPADNAV
SHLAEQLVRDANPHVRHVDLDSHGYSIARVRRDEVQMHWLRVDDVEVQGAAVREAVGLVW
RAGGGPPSKLPVTDRLQGLNQQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtggacccgggtgaccccttcggcggacgcggttccgggatccggtctgggtgcg
gcgaccaccatcaagtgggaggtggcgctggacgcgggcttccgggacgtcgtcaagcag
ggtgaggccgtcgcttccgccgaccgtgaccatactgttcacgtcgacccgtgggatctg
gcggcggacaccgtgtacttctaccgcttcgcggtcgtcgacggggagttcgcaggccat
gtctcccccaccggccgcacgagaacggccccggacttcgacgcctcgcccgagcagctg
aacctcgcggtcgcctcctgtgccaactgggagtcggggttcttttccgcgtacacggac
atcgccaatcgggcgcaggccggcgacctggacctgctggtcttcctcggcgactacatc
tacgagtatggtaccggcgaggccgcgggaccacacggccccttccgcatccatgagccc
gcctgggagaccgtcaccctgcaggactaccggatgcgccacggtcgctaccgtaccgac
cccgagctgcaggccgcgcacaccgccctgccctgggtggtggtgtgggacgaccacgag
accgccgacaactcctggcgcgggggcgcgcagaaccactcccccgccgagggcgactgg
ctgacgcgccgtaatgcggccctgcgggcctacttcgagtggctgcccgtccgcgcgacc
tccccgtccgaggaggggcacatctaccgttcgctgcgcttcggcgacctggtcgagctg
accatgatggatctgcgcacctaccgtgatcagcaggcgaggtgggcggtgggcgctatt
ggtgacgaggggcggacgatgatgggctccgagcagttcgagtggctgcggcgcaagatc
gagacctcttccgctcattggaatgtgatgggtagctcggtgatggttgcgcccctgaac
ctgatcaccctgcagcagaacgagcagacgagttcggtggcggacttcctcggttcgcac
gcatcgggagtccccttgaaccccgatcagtgggacgggtacacggctgaccgtgtgcga
ctgttggacgtgctcgaggcgcacggctcaaacgtgctgttcttgagcggcgatatccac
acggaatgggccaattcgctgtggcacggcggccgggagatcggtgtggagctggtatgc
agttccgtgtccgcaccaaatgtggacgagcagctcggactgccggccgacaacgctgtc
tcccacctggcggagcagctggtgcgcgacgccaacccgcacgtgcgccacgtggacctg
gactcacacggctactcgatcgcgcgcgtgcggcgggacgaggtgcagatgcactggctg
cgggtggatgacgtggaagtgcagggggcggcggtgagggaggctgtggggttggtgtgg
cgggctgggggagggcccccgagtaagcttcctgtgactgacaggttgcagggacttaac
cagcaataa

DBGET integrated database retrieval system