KEGG   Corynebacterium halotolerans: A605_10450Help
Entry
A605_10450        CDS       T02472                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
chn  Corynebacterium halotolerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A605_10450
Enzymes [BR:chn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     A605_10450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2297434..2299572
Genome map
AA seq 712 aa AA seqDB search
MTYQDVLRELADAHGVATSYVASDGKEKTVAEDTLLKILRALDVPLGDAPDEAEVRAALT
ALHEAEASRPLPPTVVAVEGARPTFDVHVHHGDPADVHLLLEDGSRREVTQEDNWTTPVE
VDGISWGEATFRIPGDLPQGWHTIVLQSNDRHAEATLIITPARLSTTDKYLAEPAAGVMA
QIYSVRSEDSWGIGDFHDMGLLAETLAREAGADYLLVNPMHAAEPVPPVEDSPYLPTTRR
FINPIYLRIEDLPEYDLLDASVREDVEELASELRELNRTPDFLERNPVYDGKLQVLHELF
NLRGSGKREDAFRAYKDREGQGLQDFADWCARRELDQVHAQRAHAVSPDLDELAEFYMWL
QFLCDEQLAAAQQRARDAGMSIGIMADLAVGVHPGGADAHNLAPWLAPDASVGAPPDGYN
QQGQDWSQPPWNPRKLAEAGYRPWRDLLATVLRHSGGIRVDHILGLFRLYFIPRMQSPTT
GTYVNFDHEALVGVLALEAERAGAVVIGEDLGTFEPWVQDVLAERGVMGTSVLWFESSPS
VEGPRKQEEYRKLALSSVTTHDLPPTAGYLAGEHIDLRERLGVLTTDPEEEHRGDRAWQA
QILNRVREAGEFSGTGLAERDFEGLARDERGPVGELMAGMHRFISGTPSALSCTALVDMV
GDVRAQNQPGTNNEQYPNWCVPLCDGSGEPVLIEDLAGNELFRKIAEASRRH
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
gtgacttaccaggacgtgctgagagaactcgccgacgcccacggcgtcgccacaagctat
gtcgccagtgacggcaaggagaagaccgtcgcagaggacacactgctgaagattctgcgc
gcgctcgacgtgccgcttggcgacgcccccgacgaggccgaggtccgcgcggcgctgacc
gcgctccacgaggccgaggcctcccgcccgctgccaccgaccgtcgtcgcggtcgagggg
gcgcgaccgaccttcgacgtccacgtccaccacggtgacccggccgacgtccacctgctc
ctcgaggacggttcccgccgcgaggtcacccaggaggacaactggaccacgcccgtggag
gtggacggcatttcctggggcgaggcgaccttccgcatcccgggtgacctgccccagggc
tggcacaccatcgtgctgcagtcgaatgaccggcacgccgaggccacgctgatcatcacc
ccggcgcggctgtccaccacggacaagtatctggccgagccggccgccggcgtgatggcc
cagatctactcggtgcgctccgaggactcctggggcatcggcgacttccacgacatgggc
ctgctcgccgagaccctggccagggaggccggcgcggactacctgctggtcaatcccatg
cacgcggccgaacccgtcccgcccgtggaggactcgccctacctgccgaccacccggcgg
ttcatcaacccgatctacctgcgcatcgaggacctgcccgagtacgacctgctcgacgcc
tccgtccgcgaggacgtcgaggagctggcctccgagctgcgcgagctcaaccgcaccccg
gacttcctcgagcgcaaccccgtctacgacggcaagctccaggtcctgcacgagctgttc
aacctgcgcgggtccgggaagcgcgaggacgccttccgcgcgtacaaggaccgcgagggc
cagggcctgcaggacttcgccgactggtgcgcccggcgcgagctcgaccaggtccacgcc
cagcgggcccacgccgtgtccccggatctcgacgagctggctgagttctacatgtggctg
cagttcctctgcgacgagcagctcgccgccgcccagcagcgggcccgggacgccgggatg
tcgatcggcatcatggccgacctggccgtcggcgtgcacccggggggcgccgacgcccac
aacctcgcgccgtggctggcccccgacgcgtccgtgggagccccgccggacggctacaac
cagcagggccaggactggtcccagccgccgtggaacccgcgcaagctcgcggaggccggc
taccgcccgtggcgggatctgctggccaccgtgctgcgccactccggcggcatccgcgtc
gaccacatcctgggcctgttccgcctgtacttcatcccgcggatgcagtcgccgaccacc
ggcacctacgtgaactttgaccacgaggcgctcgtcggggtgctggcgctggaggcggag
cgggccggtgccgtggtcatcggtgaggatctgggcaccttcgagccgtgggtgcaggac
gtgctggccgagcgcggcgtgatgggcacctcggtcctgtggttcgagtcctccccgtcg
gtggagggcccgcgcaagcaggaggagtaccggaagctggcgttgtcgtccgtgaccacc
catgatctcccgccgaccgccgggtacctggccggcgagcacatcgacctgcgtgaacgc
ctcggcgtgctcaccaccgatccggaggaagagcaccgcggggaccgggcctggcaggcg
cagatcctcaaccgggtgcgcgaggccggcgaattttccggtaccgggttggctgagcgc
gatttcgaggggctggcgcgtgacgagcgcggtcccgtgggcgaactgatggccggcatg
caccgcttcatctccggcaccccctccgccctgagctgcaccgcgctggtggacatggtc
ggcgacgtccgcgcccagaaccagccgggcaccaacaacgagcagtaccccaactggtgc
gtgcccctgtgcgacggttccggcgagccggtgctcatcgaggacctggccggcaatgag
ctgttccggaagatcgcggaggcgtcgcggcggcactag

DBGET integrated database retrieval system