KEGG   Cryptosporidium hominis: Chro.10139Help
Entry
Chro.10139        CDS       T00210                                 

Definition
UCHL5 protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
cho  Cryptosporidium hominis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 374 aa AA seqDB search
MSGDWCTIESDPGVFTELVERYGVKGIQFAEIYDYSESGMEFIANEYGNIYGIIFLFKFT
EKFKGNHFSQPIEAPPGMFYANQVINNACATQAILSIILNRLDIDIGSHLEEFKKFSSSF
DPMTKGLVIGNSEVLRTAHNSFRPISSLEVSDPDSNDSKGDAFHYICYIPFGKNVYELDG
LTTGVVDLGSPKVNDSENFSLDNEISALYDKPNLWVSRVMEEVKRRIELQNEDSSHGEIR
FSLLAVVPDKISVTEKKVKYLKISRQAHIAKLLSLGGDLSTDLESLSEEEIESDEFDSML
SSIPNDIALIQKEITKITHEISENLSIIQNEKYNREIWIIENERRRHDFLPFVLTLLRHA
SKKGLLMKKLSQLQ
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggggattggtgtacaatagaaagcgacccaggagtttttacagagttagtggag
agatatggagttaagggaatacaatttgctgaaatatatgactatagtgagagtgggatg
gaattcatagctaatgaatatgggaatatttatggaataattttcctctttaaatttaca
gaaaagttcaagggaaatcacttttcacagccaattgaggctcctccaggaatgttttat
gcaaaccaggtaataaacaatgcatgcgcaactcaggcgatactttcaatcatcctgaat
agattagatattgatattggatctcatcttgaagaatttaaaaagttctcaagtagcttt
gatccaatgacaaaaggacttgtaattggtaatagtgaagtattgagaaccgcacacaat
tcttttaggccaatctcttctttggaagtttctgatccagactcaaatgactccaaggga
gatgcatttcattatatttgttatattccatttggaaaaaatgtttatgaacttgatgga
cttactactggagttgtagatttaggaagtcctaaagttaatgattctgagaatttctca
ttagataatgaaatatcagcattatatgataaaccaaatctttgggtatcaagagtaatg
gaggaagttaaaagaaggattgagctacaaaatgaggattcatctcatggtgaaataaga
ttcagtttattagccgttgttccagataaaatttctgttaccgaaaaaaaagtcaaatat
ctcaaaatatccaggcaagctcatattgcaaagcttctaagtttgggaggggacttaagt
actgatttggaaagtctttctgaagaagaaattgaatctgatgagtttgattctatgtta
tcttccattccaaatgatatcgctttaattcaaaaagaaattactaagattacccatgaa
atatctgaaaatctctcaataattcagaacgaaaagtataatcgtgaaatatggattatt
gagaacgagagaagaaggcatgattttcttccttttgttcttactcttttaaggcatgca
tcgaaaaaaggtctattaatgaagaaactttctcagttacagtaa

DBGET integrated database retrieval system