KEGG   Cryptosporidium hominis: Chro.10159Help
Entry
Chro.10159        CDS       T00210                                 

Definition
protein phosphatase 2B regulatory subunit
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cho  Cryptosporidium hominis
Brite
Protein phosphatases and associated proteins [BR:cho01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Chro.10159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 158 aa AA seqDB search
MFRNESSGISEQEKLELVHAASFTRRDIIRIYSRFKALDTNQNGELDPHELFEMPEIADN
PLVKRVISIFDTNKDGKVSFVEFIIGLARLAVGSNPEEKMKFAFDIYDVNSDGWISNGEL
FKVMKMMVGDNLEDLQVSFGIMPLLLSEYFNLNFTKTN
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaaatgaatcaagtggtatttcagagcaggaaaagcttgagctagtacacgcc
gcgagctttactagaagagatatcattcgtatatactctagattcaaggcactagatact
aatcaaaatggagagcttgacccacatgagctttttgaaatgccagaaattgcagataat
ccattggtaaagcgtgtgatttctatttttgacactaataaggacggtaaagtatcattt
gttgaattcattataggtcttgcaaggttagctgttgggagtaatccagaagagaagatg
aagtttgcttttgatatttatgatgtaaatagtgatggctggatttcaaatggggagctt
tttaaggttatgaaaatgatggttggagataatttggaggatttacaagtaagttttgga
ataatgccattattactctcagagtattttaacttaaatttcactaaaacaaattaa

DBGET integrated database retrieval system