KEGG   Cryptosporidium hominis: Chro.10373Help
Entry
Chro.10373        CDS       T00210                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
cho  Cryptosporidium hominis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cho00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Chro.10373
  Replication and repair
   03420 Nucleotide excision repair
    Chro.10373
Transcription machinery [BR:cho03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Chro.10373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 174 aa AA seqDB search
MSVYPSESHHLKEWVFGSLDLLKTKKNDINEKAKENWKDIFRQISNENFEINELLLTSKD
EETLISYYGRQLIEFCNHKQLPFVSKYNASILYHRFFTNQSVMDYDPRIIIFTSISLALK
LEEFGLHFTLEKLFGDVPGLNIQEVFRHELTVCNTLKFHLYILNPRNTLEGLRL
NT seq 521 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgtatccatctgaatcacatcacttgaaagaatgggtttttggatctttagat
ttattaaaaacaaaaaaaaatgacattaatgagaaagcaaaagaaaattggaaggatatt
tttagacaaatttcgaatgagaattttgagattaatgagttgttattaacatcaaaagat
gaagaaactttaatttcttattatggtagacaattgatagaattttgtaatcataaacag
cttccatttgtttcaaaatataatgcatcaatattatatcatagattttttactaatcaa
agtgtaatggattatgatcctagaattataatatttacaagtatatcattagcattaaaa
ttagaagaatttggacttcattttacattagagaaactttttggagatgtcccaggtttg
aatatacaagaagtttttagacatgaattaactgtgtgtaatacattaaaatttcattta
tatatattaaatccaagaaatacattagaaggtttaagact

DBGET integrated database retrieval system