KEGG   Cryptosporidium hominis: Chro.10418Help
Entry
Chro.10418        CDS       T00210                                 

Definition
acetyl-CoenzymeA synthetase (acetate--coa ligase) (acyl-activating enzyme)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cho  Cryptosporidium hominis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Chro.10418
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chro.10418
   00620 Pyruvate metabolism
    Chro.10418
   00640 Propanoate metabolism
    Chro.10418
Enzymes [BR:cho01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Chro.10418
Lipid biosynthesis proteins [BR:cho01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Chro.10418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 695 aa AA seqDB search
MSDKRHGSPCSNGNDELNDSSVLTENMDTVATRSKNLPFHETYKSKPTPADKPYRVDGID
KYKELYEQSIRDPESFWSQMARKELRWLRDFTKVRSSGTCLQDRLAWFLNGKLNVCDNCV
DRWAEIQPNTTALIWEGDDPSSIRHISYIELFRNVCKMANVLKRFGIKKGDSVGIYMPMI
PETIYTMLACARIGAVHMVVFAGFAAQNLLERLVNARCKIVVTADQGSRGKKIINLKDVV
DKALEKIPEIKTCIVFRHLNGPIEFVKGRDFDGETLMRSEKPYCPLEDMDSEDPLFYLYT
SGSTGTPKGVQHSTAGYLLYAAVTQKYLFNIHPGDIFGCAGDIGWITGHSYLVYAPLCNG
ITTLIFEGVPTYPDAGRYWEMVERHRITHFYAAPTAIRTLKRLGDDFVKKHDRSSLRVLG
SVGEPINPSAWRWYHSVVGEERCSIVDTYWQTETGGIVIAPIPGCFDTKPGSATFPFFGI
EPAILDPDTGKEIDGPGSGVLCIKNSWPGMFRGIFGAHYLHEDLYTKPFPGYYFTGDGVL
RDQDGYLWITGRIDDTINVSGHRLSSKEIEDALTNHFGIAEAAAIAIDHDVKGNALVCFV
VLKDSGNRTFDLNNSSPHPFEYELRMCVRTQIGPVATPDHIIIVENIPKTRSGKVVRRLL
RKIASGCNDYGDISTVANPECIKSIESSWAQYLKR
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataaaagacatggatcgccatgttctaacggtaatgatgaattaaatgattca
tcagtacttactgagaacatggataccgttgcaactcgttccaagaacttaccgtttcac
gaaacatacaaatcaaaaccaactcctgctgataagccttatagagtagatgggattgat
aaatataaagaactctacgaacaaagtattagagatcctgagagtttttggagccaaatg
gctagaaaagaacttcgatggctaagagattttactaaagtaaggagttctggtacttgt
cttcaagatagacttgcttggtttttgaatggaaagttaaatgtatgcgataattgcgta
gatagatgggctgaaatacaaccaaatactactgcattaatttgggaaggagatgatcca
tcatctattagacatattagctatattgaactgtttaggaacgtttgtaaaatggccaat
gttttgaaacgatttggtatcaaaaaaggtgattctgttggtatttatatgccgatgata
cctgaaactatatatactatgttagcttgtgctagaataggagctgtgcatatggtagtt
tttgctggatttgcagctcagaatcttcttgagagacttgttaatgctagatgtaaaata
gtagtaactgcagatcaaggatccagaggtaagaagattattaacttgaaagatgttgtt
gataaagctcttgaaaagattcctgagattaaaacatgcattgtttttagacatttgaat
ggacctattgaatttgtcaagggaagagattttgatggagaaactttaatgagatctgaa
aaaccttattgtcctttagaagacatggatagtgaggatccactattttatttatatacc
tcaggtagtactggcactccaaaaggcgttcaacactctacagcaggatacttactttat
gctgccgttacacaaaagtacttgttcaacattcatcctggcgatatttttggatgtgct
ggagatattggatggattactggccactcttacttggtatatgctcctctttgtaatggt
ataaccactttaatttttgagggagtaccgacttatcctgatgctgggagatactgggaa
atggtggagagacacagaattactcatttttacgctgctccaactgcaatcagaactctt
aaacgccttggagatgattttgttaaaaagcacgatagatcatcattgagagttctagga
tcagttggagagcctattaatccctctgcatggagatggtaccattcagttgttggtgaa
gagagatgttctatagttgatacttattggcaaactgagacaggaggaattgttattgct
ccaattcctggctgttttgatactaaacctggttcagcaacatttcctttctttggtatt
gagcctgcgatacttgatcctgatacaggaaaagaaattgatggaccagggtctggagtt
ctttgtataaaaaactcatggccaggtatgtttagaggaatttttggagctcattatctt
catgaagatctttatacaaaaccattccctggatactattttactggggatggtgtttta
agagatcaggatggatatctttggattactggtagaattgacgatacaattaatgtttct
ggtcatagactaagctccaaggaaattgaagatgctcttaccaaccattttggaattgca
gaagctgcagctattgcaattgatcatgatgtcaaaggtaatgctcttgtttgctttgta
gttttaaaggattctggcaatagaacttttgacttgaataattcaagtcctcatcctttt
gagtatgaacttaggatgtgtgtcaggacccaaatcggccctgttgcaacacctgatcat
attattattgttgagaatatccctaaaacaagatcaggaaaagttgtaagacgtcttctt
agaaagattgctagtggttgcaatgactatggagatatttcaacggttgcaaatcctgag
tgtattaaatccattgagtcatcctgggcacaataccttaagagatga

DBGET integrated database retrieval system