KEGG   Cryptosporidium hominis: Chro.20043Help
Entry
Chro.20043        CDS       T00210                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
cho  Cryptosporidium hominis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cho00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Chro.20043
Translation factors [BR:cho03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Chro.20043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 724 aa AA seqDB search
MFKVTREELGEDIDLLEYLSDSTYDGEETEEYISKRCNTIEEPLTLSDSFSKSFVIFGLP
CIGSDKYERFLKALRTIINQTLKMMRVEYDENFLLDVPQDEDGGTKGVAILTFSNSFQAE
TVCQALSKAPFDKQTKFNTVMFDDVKRIIEQDESAPGHFETLYPPPTLFSRDDVRNWLMG
PRCREQFVIRYQSATEIYSFDSIQRIPELIYDGERAKGGKRVWTDFSVQWSPMGSYLVTF
HRQGVALWGGDDWDKKIRFEHKDVKFIDFSPNEEYLLTWDGSSPDSRFDKAVKVWHVLSG
RLLRCFSTPTMTLNNNGTDSGLHFLWSPTGNYLAHCSDKGELFVYESSTMTLVEDPATGN
KNPLKYPLQFFDWSPEEDNLSIWCPERGDTPGRLTLLSIKNRKELAIKNVFNVREASVHW
QPKGQYMCLKALVSRKAGKKAKKEYTQLEIFRVKEKNVPVDTVHIEGVTVKCLSWESSNR
FAIVVVDDVTRSQTLRFYQVNATQTDFVCSYYLTSPVDTIKWSPLGSYFVLGGSGGNLTF
CQLTNENKFDILQKDEHFMCNWIQWDPTGRYVTTAFQSKLAEGAYKYSTETGFIVWSFQG
RQLYNSPLETFYQFIWRPHPPSLLSQEKFDEIPRKLKDYSKKFDAEDEAVRSEKRNIVLQ
KRKVNEDEFNAILQKIQEWKVQQPLYKEWLAAKEVLLNSLQWEEQEEVIEIELETIQEVI
STEV
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagttactcgtgaagaattaggtgaagatattgatcttttggaatatttaagt
gactccacatatgatggggaggaaactgaagaatatatttccaagagatgtaatacaata
gaagaaccactgactttatcagactcattttctaaaagctttgttattttcggacttcca
tgtattggctcagataaatatgagagatttcttaaagctcttagaacaattattaatcaa
acccttaaaatgatgagagtggagtatgacgaaaattttttacttgatgtacctcaggat
gaagatggaggcacaaaaggagttgctatattgacattttcgaattcattccaagcagaa
actgtttgccaagcactttcaaaggcaccatttgataaacagacaaaatttaatacagta
atgtttgatgatgtaaaaagaattattgaacaagatgaatcagctccaggacactttgaa
actctatacccaccaccgactttattcagtcgagatgatgtaagaaattggttaatgggg
ccaagatgtagagaacaatttgttattagataccaaagcgcaactgagatctattcattt
gattcgattcaaagaattcctgaattaatttatgacggtgaaagagctaaaggagggaaa
agagtttggacagatttttctgtacaatggagtccaatgggttcttacttagtgacattc
catcgtcagggtgttgcactttggggaggtgatgattgggataagaagattagatttgaa
cacaaagatgttaaattcattgatttcagcccaaatgaagagtacttactaacatgggat
ggttcttctccagattcaaggtttgataaggcagtaaaggtatggcatgtactttctgga
cgacttttaagatgcttttccacaccaactatgacacttaacaataatggaactgatagt
ggtttacatttcctttggagcccaactggaaattatcttgcacattgctctgataaagga
gaacttttcgtctatgaatcttccacaatgactcttgtagaagatcctgctacaggtaat
aagaacccattaaagtatccacttcagttctttgattggtcccctgaagaagacaacctt
tcaatttggtgtccagaaagaggagatacaccaggtagactcactttgctttctattaag
aatagaaaggagttggcaataaagaatgtctttaatgttagagaggcatctgtccactgg
caaccaaaaggtcagtatatgtgtcttaaggctctagtttctagaaaagctggtaaaaag
gcaaaaaaagaatatactcagcttgagatctttagagtaaaagagaaaaatgttcctgtt
gatactgtacatattgaaggtgttactgtcaagtgcttatcctgggaatcatctaataga
tttgccattgttgttgtagatgatgttacaagatcccaaacactgagattttaccaagtg
aatgcaacacaaactgactttgtatgctcatattatttaacatctcctgttgacacaatt
aaatggagtccacttggtagctattttgttttaggtggatctggaggaaatttaacattc
tgtcaactcacaaatgaaaacaaatttgatatcttgcaaaaagatgagcattttatgtgt
aactggattcaatgggatcctaccggtagatatgttacaacagctttccaatcaaaatta
gctgaaggtgcatataaatacagcacagaaacaggtttcatagtttggtctttccaaggt
agacaactttacaactcaccattggaaacattttaccaatttatttggaggcctcatccc
ccttcacttctttcacaagaaaagtttgatgaaattcccagaaaacttaaagattacagc
aaaaagtttgatgctgaagatgaggctgtcagatctgaaaagagaaatattgttctccaa
aagagaaaagtcaacgaggatgaattcaatgctattctccaaaagattcaagaatggaag
gttcagcaaccactttacaaagaatggctcgcagcaaaagaagtcctacttaattcctta
caatgggaagaacaagaagaagttatcgagattgagcttgaaactatacaggaagttatt
tccactgaggtttag

DBGET integrated database retrieval system