KEGG   Cryptosporidium hominis: Chro.20223Help
Entry
Chro.20223        CDS       T00210                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
cho  Cryptosporidium hominis
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cho00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Chro.20223
  Replication and repair
   03420 Nucleotide excision repair
    Chro.20223
Transcription machinery [BR:cho03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Chro.20223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 453 aa AA seqDB search
MSIERSFDYKTSSLSSWNLQEYIATLSSTNACLLFEDISCVTELFSSLSEIQQNIVSRLM
ILGSGYGNYIGEQAMNIWILTTKRNELEYAIRRLRSLKIIKVNVLDSNSQKSSSDSISVQ
YQLNPIFQKTLSKFLYEGDIFNGFEIPKRKSEIKISYESLTKFVRKQWSNILNIIVQLSG
SQNIPKNSANTFYKFKLISPDTIKVLDNIHLISCDIGKYNKKNSPNSKGLRIQIYSSLSR
ESSEQLFDGFDQEDRFGSQNDQNALDIYNEIKYDMAGSNSNSEEEYLPTNNLKIKPKKRV
INSKHTLAKNQVDKIFEQKLAPKAFCWLLCDSCNQLLMLLNGFIKLVELESTIENGEYKF
SQITSENILNPPIPNVISLILRISSSKIGQPISIHKKTNNNILMRFILFAYDLGLLYIDE
SIIESSLYSLKNRFENLRDLNIELLYTTPFSLL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatagagagatcttttgattataaaacttcatctctttcatcatggaatttacaa
gaatacatagcaactttgtctagcactaatgcatgcctattatttgaagatatttcttgt
gtaactgaattattttcgtccctttctgagatacaacagaatattgtgtctagacttatg
attttgggaagtggatatggaaattacataggagaacaagctatgaatatatggatactt
acaacaaaaagaaatgaattggaatatgcaattaggagattaagatcattgaaaataatt
aaagtcaatgtactagattctaactcccaaaaaagttcatctgattctatttctgtgcaa
taccaattaaacccaatatttcaaaaaactttatctaaatttttgtatgaaggggatata
tttaatggatttgaaataccaaagagaaaatccgagataaagatctcgtatgaatctctc
acgaagtttgtaagaaaacaatggagtaatattttaaacattattgttcaattaagcgga
agtcaaaatattccaaaaaatagtgctaatacattttataaattcaaattaatttccccg
gacacaataaaagttctggataatatccacttaatttcttgcgatattgggaaatacaac
aaaaaaaattctccgaattcaaagggacttagaattcaaatttatagtagtttatctcga
gaaagtagtgaacagttatttgatggctttgatcaagaggatagatttggatcccaaaat
gaccaaaatgcactagacatatacaacgagataaaatacgatatggctggaagcaattct
aacagtgaagaagaatatttgccaaccaataatttaaaaattaaaccaaagaagagagtt
attaattccaaacatacccttgcaaaaaaccaagttgataaaatatttgaacagaagttg
gcaccaaaagctttttgttggttactttgtgatagctgtaatcaattgttaatgcttctt
aatggatttataaaattagtagagcttgaatcaaccattgaaaatggagaatacaaattt
agtcaaataaccagtgaaaatatactaaacccaccaattccaaatgtaataagtctaata
ctgcgtatttcaagttcaaaaattggccagccaatttcaatacataagaaaacgaataat
aatattttgatgcgatttattttgtttgcatatgatttaggactactctatattgatgaa
tctattattgagagtagtctatattctttgaaaaatagattcgaaaatcttcgtgattta
aatattgaattattatatactactcctttttcattgttg

DBGET integrated database retrieval system