KEGG   Cryptosporidium hominis: Chro.20246Help
Entry
Chro.20246        CDS       T00210                                 

Definition
glutamate 5-kinase (gamma-glutamyl kinase) (GK)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cho  Cryptosporidium hominis
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Chro.20246
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Chro.20246
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Chro.20246
Enzymes [BR:cho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Chro.20246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 438 aa AA seqDB search
MVKFGTYIIENNDNGPQLIRREKSGPLIVLKVGTSTLTNSRTGKLSVSNIGALVETVCDL
MDKGCRVVLVSSGAVGAGLLHMNIREKPNKLHLKHAIAAIGQPLLMRVYEDFFSMRGAKV
AQLLMTRSDFVNKDRFIDFKNTLLDLIHWNVVPIINENDSVTTIDLHFGDNDTLAAYCAI
AISADWLILATDVDALFTKNPRLHRDAVPILKVNNIDSIIHMENDVSDENCGTNFGTGGM
RTKIFAARIAAAAGISTFLVNGSHPNRLLQLVDSIDFKMNKAHNNNAISSYYSPTSEAND
LEKVSLCESLDMNSSSIESLADTKTCFEHSYSSIVGNFIEETPESTQVDNGIITCALEEL
YQGEYIGTIFARQALTQAMKNHKRWIMSLPISGKIFLDKGAIKSVTVDSKSLFSVGIVNV
KGKFETGDVVSIICDGDK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggttaaatttggtacatacattatagagaacaatgataatggaccacaattaataaga
agagaaaagtctgggccattgattgtcttaaaggttggaacatcaactttaacaaatagc
aggacaggcaaactttcggtttcaaatatcggtgcgttggtggaaacagtctgtgattta
atggataaaggatgtagagttgtattagtgtcttccggggctgttggagctgggttgctt
cacatgaatatcagagaaaaaccaaataagcttcacctgaaacatgcaatagctgctatt
ggccagccactactaatgagagtttatgaagactttttttctatgagaggcgcaaaagtt
gctcaattactaatgactagatcagactttgtcaacaaagatagatttattgactttaag
aacacactattggatttgatacattggaacgttgtcccaataataaatgaaaatgactct
gtaacaactattgatcttcatttcggcgataatgatacactagcagcttactgtgcaatt
gcaatatcagcagattggttaatattggctactgatgttgatgcactttttacaaaaaat
cctcgacttcatagagatgccgttccaatactaaaagtaaacaatattgattccattatt
catatggaaaatgacgtttcagatgaaaattgtggcactaattttggaactggaggcatg
agaactaagatttttgctgcgaggattgcggctgcagccggaatttcaacatttttagtg
aatgggtcgcaccccaacagactattgcaactagtagactcaatagattttaaaatgaat
aaggctcataataacaatgcaataagttcgtattatagtcctactagtgaagccaatgat
ttagaaaaggttagtctgtgtgaaagcttggatatgaattctagtagcattgaaagcctt
gctgatacaaaaacatgtttcgagcattcctactcctctatagttggtaactttatcgag
gaaaccccagaatcaacacaagtagataatggtataattacatgtgctttagaagaacta
tatcaaggagaatacattggtactatttttgctaggcaggctctaactcaagctatgaaa
aatcataaaaggtggataatgagcctacctatttctgggaaaatatttctcgataaagga
gccatcaaatctgttactgtcgactcaaaatcccttttttctgtgggaattgtcaacgtg
aagggtaaatttgaaacaggagatgttgtttccattatttgcgacggagacaaatga

DBGET integrated database retrieval system