KEGG   Cryptosporidium hominis: Chro.20366Help
Entry
Chro.20366        CDS       T00210                                 

Definition
ubiquitin specific protease 66
Orthology
K01072  
ubiquitin thiolesterase [EC:3.1.2.15]
Organism
cho  Cryptosporidium hominis
Brite
Enzymes [BR:cho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Chro.20366
Peptidases [BR:cho01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Chro.20366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 382 aa AA seqDB search
MGNSVPSSSSSVSSETVNTNRNGAENMSSPIGIKNFGNTCYMNAGLQFISAMGIFTEENF
GGMKLNKSSSEEVCRSLISILIQLGKPSRITDAISPYQLFKQLRQQNSDLFNQHQQDAHE
FIMYILEIIHDGTIKPCNTPKLSNEDLEKLSKKSTRPGNVFWNNHMMRNNSILNNTICGQ
FRSRITCENCGNNSDTFDPFWDITLALPEVSDDYEKISIGSCFRKFFEQQNLFHENDEPN
YNCSHCKSVVNATRCINISQFPNVLLVTLKRFNNNGEKCNGIVSFKTAGIILKSLTEIGH
FKLVAVLQHNGSTLFQGHYISYVFKKEFNGWFKFDDDIVTLVDDILEEDIQAYCLLYVLE
SKSALNSNSEQAYSVGIRNQRN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgggaaattcagttccctcatcttcatcatcagtatcatcagaaacagttaatacgaat
aggaacggggctgaaaatatgagtagtccaataggaataaagaattttgggaacacgtgt
tatatgaatgctgggttacagtttatatcagcaatgggaatctttacggaagagaatttt
ggagggatgaaacttaataagagctcctcagaggaggtttgtaggtcattaatatcaatt
ttaattcagttaggaaaaccaagtagaatcacagatgcaatttctccatatcaacttttt
aagcaacttagacaacagaactctgatctttttaaccagcatcaacaagatgcacatgaa
tttattatgtatattttggaaataatccatgatgggactattaaaccatgtaatactcca
aagctgtcaaacgaagatcttgagaaattgagcaaaaaatcaactcgaccaggaaatgtt
ttttggaataaccatatgatgagaaataattcgattttgaataatacaatatgtggacag
ttcagaagtagaataacttgtgagaattgtggaaataatagtgatacttttgatcctttt
tgggatataacattggctcttcctgaagtttcagatgattatgagaagatttcaattggg
tcttgctttagaaagttttttgagcaacagaatctttttcacgaaaatgatgaaccaaat
tacaattgttcccattgtaagagtgttgtaaacgcaacaagatgtataaatatttcgcag
ttcccaaatgtattgcttgtaactttaaagaggtttaataacaacggagaaaaatgtaat
gggattgtttcctttaaaacagcaggaataatactcaaatctcttacagagattggccac
ttcaagttagtagcagtgcttcaacacaatggaagtactcttttccaaggccattatatc
tcctatgttttcaaaaaggagttcaacggatggtttaaatttgatgatgatatagtcact
ttagtagacgatattctcgaggaggatattcaggcttactgccttctttatgttctcgag
tcaaagagcgctttgaactccaactctgaacaagcttattctgtgggcataaggaatcag
agaaattag

DBGET integrated database retrieval system