KEGG   Cryptosporidium hominis: Chro.20435Help
Entry
Chro.20435        CDS       T00210                                 

Definition
(RefSeq) replication protein A2; CpRPA2
  KO
K10739  replication factor A2
Organism
cho  Cryptosporidium hominis
Pathway
cho03030  DNA replication
cho03420  Nucleotide excision repair
cho03430  Mismatch repair
cho03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cho00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Chro.20435
   03420 Nucleotide excision repair
    Chro.20435
   03430 Mismatch repair
    Chro.20435
   03440 Homologous recombination
    Chro.20435
DNA replication proteins [BR:cho03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Chro.20435
DNA repair and recombination proteins [BR:cho03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Chro.20435
   MMR (mismatch exicision repair)
     Chro.20435
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Chro.20435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RMI2
Motif
Other DBs
NCBI-GeneID: 3412136
NCBI-ProteinID: XP_665492
Position
2
AA seq 362 aa AA seqDB search
MNFGGNNKPFGGFGMDDLNESGGFMIDGNDSSMQNGNERKQSVGNEQKLAPLKVGMILRS
YSNFVTLSRFQLFDKDINLFKLVGFVRNVEHDDYPQRLRFYLDDGSGLILIDWLVDNTGT
KYKQDLVNSIHEGCFVKIFGELTLMVSEPSVRAFVVRPLVCTDEISLHDIDVASYIVRSM
YGNTYDSGKVQLSDSNVIINKQGSMNYGGAGDSVKDSNQSIVSSMFNLSGQFGSNSNNNT
NNKNEGNFNNYGSNNNFGNEQNISMNKPPIRVVSAIAPKSNQFSSGAGVQSNPLKLREII
SSVLDQASNEGNPEMTIDGIFDSLLTRDVHATHDDIRNQLKNLVGEAKVYQTNPHTWRAT
GY
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaattttggtggaaataataaaccttttggaggatttggaatggacgatttgaatgaa
tctggtgggtttatgattgatgggaatgatagttccatgcaaaatggtaatgaaagaaaa
caaagtgtaggaaacgaacagaaattagcaccattaaaagttggtatgattcttcgatca
tatagcaattttgtaacattaagcagatttcaactttttgacaaagatattaacttgttc
aagttagtaggatttgttagaaatgttgagcatgatgattatccacaaagactacgtttt
tatttagatgatggatcaggattaatcctaatagactggctagtagataatacagggaca
aagtacaaacaggatttggtaaattctatacacgagggatgctttgtaaagatatttggg
gaattgactttaatggtttcggaaccatcagtaagagcttttgtagtgcgcccattagta
tgtactgatgagatttcattacacgatattgatgttgcaagctatatagtaagaagtatg
tatggcaatacttatgattcaggaaaagtacaactttctgactctaacgtaataattaac
aaacaaggatcaatgaattacggaggtgcaggagattctgtaaaggattcaaatcaaagt
attgtatcttcaatgtttaacttaagcggacaatttggaagtaatagcaacaataatacg
aataacaaaaatgaaggtaactttaataattatggaagtaataacaactttggtaatgaa
cagaatatctcgatgaataaaccaccaatcagggtagtttcagctattgcaccaaagtct
aatcaattcagttcaggagctggagttcaaagtaaccctctaaagttaagagaaatcatt
tcctctgtattagaccaagcatcaaatgaaggtaacccagaaatgactattgatggaatc
tttgactctttattaacaagagatgttcatgccacacatgatgacattaggaatcagctt
aagaatttggttggagaagcaaaagtttatcagaccaatcctcatacttggagagctact
ggatattaa

DBGET integrated database retrieval system