KEGG   Cryptosporidium hominis: Chro.20435Help
Entry
Chro.20435        CDS       T00210                                 

Definition
replication protein A2; CpRPA2
Orthology
K10739  
replication factor A2
Organism
cho  Cryptosporidium hominis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:cho03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:cho03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:cho03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cho03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 362 aa AA seqDB search
MNFGGNNKPFGGFGMDDLNESGGFMIDGNDSSMQNGNERKQSVGNEQKLAPLKVGMILRS
YSNFVTLSRFQLFDKDINLFKLVGFVRNVEHDDYPQRLRFYLDDGSGLILIDWLVDNTGT
KYKQDLVNSIHEGCFVKIFGELTLMVSEPSVRAFVVRPLVCTDEISLHDIDVASYIVRSM
YGNTYDSGKVQLSDSNVIINKQGSMNYGGAGDSVKDSNQSIVSSMFNLSGQFGSNSNNNT
NNKNEGNFNNYGSNNNFGNEQNISMNKPPIRVVSAIAPKSNQFSSGAGVQSNPLKLREII
SSVLDQASNEGNPEMTIDGIFDSLLTRDVHATHDDIRNQLKNLVGEAKVYQTNPHTWRAT
GY
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaattttggtggaaataataaaccttttggaggatttggaatggacgatttgaatgaa
tctggtgggtttatgattgatgggaatgatagttccatgcaaaatggtaatgaaagaaaa
caaagtgtaggaaacgaacagaaattagcaccattaaaagttggtatgattcttcgatca
tatagcaattttgtaacattaagcagatttcaactttttgacaaagatattaacttgttc
aagttagtaggatttgttagaaatgttgagcatgatgattatccacaaagactacgtttt
tatttagatgatggatcaggattaatcctaatagactggctagtagataatacagggaca
aagtacaaacaggatttggtaaattctatacacgagggatgctttgtaaagatatttggg
gaattgactttaatggtttcggaaccatcagtaagagcttttgtagtgcgcccattagta
tgtactgatgagatttcattacacgatattgatgttgcaagctatatagtaagaagtatg
tatggcaatacttatgattcaggaaaagtacaactttctgactctaacgtaataattaac
aaacaaggatcaatgaattacggaggtgcaggagattctgtaaaggattcaaatcaaagt
attgtatcttcaatgtttaacttaagcggacaatttggaagtaatagcaacaataatacg
aataacaaaaatgaaggtaactttaataattatggaagtaataacaactttggtaatgaa
cagaatatctcgatgaataaaccaccaatcagggtagtttcagctattgcaccaaagtct
aatcaattcagttcaggagctggagttcaaagtaaccctctaaagttaagagaaatcatt
tcctctgtattagaccaagcatcaaatgaaggtaacccagaaatgactattgatggaatc
tttgactctttattaacaagagatgttcatgccacacatgatgacattaggaatcagctt
aagaatttggttggagaagcaaaagtttatcagaccaatcctcatacttggagagctact
ggatattaa

DBGET integrated database retrieval system