KEGG   Cryptosporidium hominis: Chro.20465Help
Entry
Chro.20465        CDS       T00210                                 

Definition
(RefSeq) mitogen-activated protein kinase 2
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cho  Cryptosporidium hominis
Pathway
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:cho00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Chro.20465
Enzymes [BR:cho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Chro.20465
Protein kinases [BR:cho01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Chro.20465
Chromosome [BR:cho03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     Chro.20465
Exosome [BR:cho04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Chro.20465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 566 aa AA seqDB search
MMKYPDGDYMTTINTVGERSKLVSEVSMNVANPNISGRMGEKQTRVVQIDNSRVTSVGME
PEMKSDLDCNGGYTSANCTNIVKGKNQEDREVTQNKPLERIGPNNTDFRNSKSTSTTASS
HSGSSLSHPHNKWSIPSRYQVRHLIGTGSYGHVCEAYDSKENRLVAIKKIHRVFEDLVDC
KRILREIAILSRLNHDHIVKILDICVPEDTEHFDEIYLVLEIADSDFKKLFRTPVYLSEL
HVKTLLYNLLVGLKYIHSAGIYHRDLKPANCLVNQDCGVKICDFGLARTVKRPTDTINYN
SVASNNNNNNNNSVVNRRSIMTGTSIKSDNSQENGGFQQGGRFLKRQLTGHVVTRWYRAP
ELILLQENYTEAIDMWSVGCIFAELLNMLKENVAYYSDRSPLFPGSSCFPLSPDNKQQTE
DYRFKIRGNRDQLNMIFNVLGSPLDEDIEVLEKEDAKRYIRIFSKRTGIDLQTRFPGASS
QSIDLLKKMLVFNPNKRITVDEALSHSLFKNIRNEMLEIISHEKVTLPFDDWSSMTEREL
RYFFLKEIQRFSPDLVIPDSIKMDID
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatacccagatggagattatatgacaacgattaatacggttggagaaaggtca
aagctagttagtgaagtttctatgaatgtagcaaatccaaatatttccggaagaatggga
gagaaacaaaccagagttgttcagattgacaattcaagagttacaagtgtagggatggaa
cctgagatgaaatctgacttagattgcaatggcggctacacgtctgctaactgtacaaat
atagtcaaaggaaaaaatcaggaagacagagaagtcacacaaaataaaccattagaaaga
ataggtccaaataatacagattttagaaatagtaaatcaacttctacaacagcatcatct
cattcaggctcttcactttctcaccctcataataaatggagtataccttcaagatatcaa
gtaagacacttaattggtacaggctcttatggccatgtatgcgaggcatatgatagtaaa
gaaaaccgtttagtggcaattaaaaagattcatcgagtttttgaggatttagttgattgt
aaaaggattttgagggaaattgcaatattaagtaggctgaaccatgatcatatagttaaa
attttggatatctgcgttccagaagataccgaacactttgatgaaatttatttggtattg
gagattgccgatagtgatttcaaaaagttgtttagaaccccagtatatctatcagaatta
catgtaaaaacactactatataatctcttagttggacttaaatatatccattcggcagga
atttatcatagagatttaaagccagcaaattgcctagttaatcaagactgtggagtaaaa
atttgtgactttggattagccagaacggttaaaaggcctacagatacgataaattataac
tctgttgcaagcaataataataataataataataattcagtggtgaataggagatctata
atgactggtactagtattaagagtgataattcgcaagaaaatggaggatttcaacaggga
gggaggtttttgaaacgtcaacttactggacatgtagtaacaagatggtaccgtgctcct
gaacttattttattgcaagaaaattatactgaagctattgatatgtggagtgttggatgt
atttttgctgaacttcttaacatgcttaaagagaatgtagcatattatagtgatagaagt
ccgcttttcccaggtagcagctgtttcccactttcacctgataataaacaacaaactgaa
gattatcgttttaaaattagaggaaatagagaccaactaaatatgattttcaacgtcttg
ggttctccattagacgaagatattgaagttctagaaaaagaagatgcaaaaagatatatt
cgtattttcagtaagagaacaggaattgacttacaaacaaggttcccaggtgcttcaagc
caatcaattgatttactcaagaagatgttggtttttaatcctaataaaaggattactgtt
gacgaagctttgagtcattcgctctttaaaaatataagaaacgagatgctcgaaattata
tctcatgaaaaagtaacacttccattcgatgattggagctctatgacagagcgagaacta
agatatttctttttaaaggagatacaaagattttctcctgacttggtcattccagattcc
attaaaatggatattgattaa

DBGET integrated database retrieval system