KEGG   Cryptosporidium hominis: Chro.20465Help
Entry
Chro.20465        CDS       T00210                                 

Definition
mitogen-activated protein kinase 2
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
cho  Cryptosporidium hominis
Brite
Enzymes [BR:cho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Chro.20465
Protein kinases [BR:cho01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Chro.20465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 566 aa AA seqDB search
MMKYPDGDYMTTINTVGERSKLVSEVSMNVANPNISGRMGEKQTRVVQIDNSRVTSVGME
PEMKSDLDCNGGYTSANCTNIVKGKNQEDREVTQNKPLERIGPNNTDFRNSKSTSTTASS
HSGSSLSHPHNKWSIPSRYQVRHLIGTGSYGHVCEAYDSKENRLVAIKKIHRVFEDLVDC
KRILREIAILSRLNHDHIVKILDICVPEDTEHFDEIYLVLEIADSDFKKLFRTPVYLSEL
HVKTLLYNLLVGLKYIHSAGIYHRDLKPANCLVNQDCGVKICDFGLARTVKRPTDTINYN
SVASNNNNNNNNSVVNRRSIMTGTSIKSDNSQENGGFQQGGRFLKRQLTGHVVTRWYRAP
ELILLQENYTEAIDMWSVGCIFAELLNMLKENVAYYSDRSPLFPGSSCFPLSPDNKQQTE
DYRFKIRGNRDQLNMIFNVLGSPLDEDIEVLEKEDAKRYIRIFSKRTGIDLQTRFPGASS
QSIDLLKKMLVFNPNKRITVDEALSHSLFKNIRNEMLEIISHEKVTLPFDDWSSMTEREL
RYFFLKEIQRFSPDLVIPDSIKMDID
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatacccagatggagattatatgacaacgattaatacggttggagaaaggtca
aagctagttagtgaagtttctatgaatgtagcaaatccaaatatttccggaagaatggga
gagaaacaaaccagagttgttcagattgacaattcaagagttacaagtgtagggatggaa
cctgagatgaaatctgacttagattgcaatggcggctacacgtctgctaactgtacaaat
atagtcaaaggaaaaaatcaggaagacagagaagtcacacaaaataaaccattagaaaga
ataggtccaaataatacagattttagaaatagtaaatcaacttctacaacagcatcatct
cattcaggctcttcactttctcaccctcataataaatggagtataccttcaagatatcaa
gtaagacacttaattggtacaggctcttatggccatgtatgcgaggcatatgatagtaaa
gaaaaccgtttagtggcaattaaaaagattcatcgagtttttgaggatttagttgattgt
aaaaggattttgagggaaattgcaatattaagtaggctgaaccatgatcatatagttaaa
attttggatatctgcgttccagaagataccgaacactttgatgaaatttatttggtattg
gagattgccgatagtgatttcaaaaagttgtttagaaccccagtatatctatcagaatta
catgtaaaaacactactatataatctcttagttggacttaaatatatccattcggcagga
atttatcatagagatttaaagccagcaaattgcctagttaatcaagactgtggagtaaaa
atttgtgactttggattagccagaacggttaaaaggcctacagatacgataaattataac
tctgttgcaagcaataataataataataataataattcagtggtgaataggagatctata
atgactggtactagtattaagagtgataattcgcaagaaaatggaggatttcaacaggga
gggaggtttttgaaacgtcaacttactggacatgtagtaacaagatggtaccgtgctcct
gaacttattttattgcaagaaaattatactgaagctattgatatgtggagtgttggatgt
atttttgctgaacttcttaacatgcttaaagagaatgtagcatattatagtgatagaagt
ccgcttttcccaggtagcagctgtttcccactttcacctgataataaacaacaaactgaa
gattatcgttttaaaattagaggaaatagagaccaactaaatatgattttcaacgtcttg
ggttctccattagacgaagatattgaagttctagaaaaagaagatgcaaaaagatatatt
cgtattttcagtaagagaacaggaattgacttacaaacaaggttcccaggtgcttcaagc
caatcaattgatttactcaagaagatgttggtttttaatcctaataaaaggattactgtt
gacgaagctttgagtcattcgctctttaaaaatataagaaacgagatgctcgaaattata
tctcatgaaaaagtaacacttccattcgatgattggagctctatgacagagcgagaacta
agatatttctttttaaaggagatacaaagattttctcctgacttggtcattccagattcc
attaaaatggatattgattaa

DBGET integrated database retrieval system