KEGG   Cryptosporidium hominis: Chro.30063Help
Entry
Chro.30063        CDS       T00210                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cho  Cryptosporidium hominis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cho00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Chro.30063
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Chro.30063
Enzymes [BR:cho01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Chro.30063
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 200 aa AA seqDB search
MGNFLASTKITTDLASKSVYSYTLTTLEGNLFPMESLKGKVVMVTNVASKCGYTKSYYKQ
MVRIYSVFAPLGLEIIGLPSREFMGQEFEDPKEIRKFADSHNVKFPLMEICKVNGPDALE
FVQKLKRETPELYDEKSNTLSAIKWNFSRFLIDKNGKVVAFRGTRTEPNELIPKIAELLG
VSDYQNLFKNYDKLHPEVRL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggggaattttttagcatctacaaagataacaaccgatcttgcgagcaagtctgtgtac
tcttatacacttacaactctcgaaggaaatctttttcctatggaaagcttgaaagggaaa
gtcgtaatggtaacaaatgttgcatccaaatgtggctacacaaaatcttattataaacaa
atggtgagaatctactctgtgtttgctcctcttggacttgagattattggtctaccctcc
agagagtttatgggccaagaatttgaagatcctaaagagattcgcaaattcgcagattct
cataatgttaaattccctctgatggagatttgtaaagtaaatggcccagatgctttggaa
tttgtacaaaagctgaaaagagagactcctgagttatatgatgagaaaagtaacacttta
tctgcaataaaatggaacttttcaaggtttttaattgataaaaatggaaaagttgttgca
tttagaggcactaggaccgagcctaatgagcttattccaaaaatagctgaacttcttggt
gtttctgattaccagaatctttttaaaaattatgacaagctccatccagaagtcaggtta
tga

DBGET integrated database retrieval system