KEGG   Cryptosporidium hominis: Chro.30240Help
Entry
Chro.30240        CDS       T00210                                 

Definition
choline kinase GmCK2p-like protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
cho  Cryptosporidium hominis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cho00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Chro.30240
Enzymes [BR:cho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Chro.30240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 400 aa AA seqDB search
MPFPNKKIELGDKLSESIRSFSTITDTEIIIGICRKNIPGWKEINESYIEVKQIFSGLTN
QLFVVSIVNESMSLSLKHPRILFRIYGKHVGKFYDSKVELDVFRYLSNINIAPNIIADFP
EGRIEEFIDGEPLTTKQLQLTHICVEVAKNMGSLHIINSKRADFPSRFDKEPILFKRIYL
WREEAKIQVSKNNFQIDKELYSKILEEIDQLEELIMGGEKFSMERALELKLHSPAFSLVF
AHNDLQENNLLQTQNNIRMIDYEYSAINFAGADIANYFCEYIYDYCSDKQPYFKFKYEDY
PCEELRKLFISVYLSQTLQEQVMPSQQIVHIMTKAVEVFTLISHITWGLWSIARTPGYQP
NSVEFDFTEYANTRFTHYLQKKKELIDQGILPLNSWLFNL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgccattcccaaacaagaaaatcgaactaggtgacaaattatcagaatcaattaggtct
ttctcaactattacagatactgagataataataggtatatgccgaaaaaatattccaggt
tggaaagaaattaatgagtcgtatattgaagttaaacagatcttttcaggactcacgaac
cagctttttgttgtaagtattgtaaatgaatccatgagtttatctctaaaacatccgaga
attctatttagaatttatggtaaacatgtaggaaaattctatgattccaaagtggagctt
gatgtattcagatatctgagcaacattaatattgctccaaacataattgcagattttcca
gaaggtagaatagaagagttcattgatggtgagcctttgacaactaaacaattacagtta
acccacatttgtgtagaagtggcaaagaatatgggatctttacacattattaattcaaaa
agagcagatttcccttcaaggtttgacaaggagccaattctcttcaaaagaatatatctt
tggagagaagaagctaagatccaagtgtccaaaaacaatttccagattgataaagaattg
tactcaaagatattggaagagattgatcaattagaggaattgatcatgggcggagaaaag
ttcagtatggaaagggctttagaattaaaacttcattctccagcattttctttggtattt
gctcataacgatcttcaagaaaacaatctgttgcagacgcaaaacaatattagaatgatt
gattatgagtattcagctataaactttgcaggggcagacatcgcaaactacttttgtgag
tatatatatgattactgtagtgacaaacaaccatatttcaaatttaaatatgaagattat
ccatgtgaagagctgcgaaagctatttatttcagtgtatttgtctcaaacattacaagaa
caagttatgccaagtcaacaaatcgtgcacattatgactaaggctgttgaagtattcact
ctaatttcccatattacatggggactgtggtctattgcaagaactccagggtatcagcca
aactctgtggaatttgactttacagaatatgcaaatactcgatttacgcattatttgcaa
aaaaaaaaagaactaattgatcagggaatattaccgcttaacagctggctatttaattta
taa

DBGET integrated database retrieval system