KEGG   Cryptosporidium hominis: Chro.30344Help
Entry
Chro.30344        CDS       T00210                                 

Definition
protein kinase, cAMP-dependent, catalytic chain (EC:2.7.1.37)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cho  Cryptosporidium hominis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 392 aa AA seqDB search
MDGIWKRLVSGGKNHSSKEGGNSQKNAVAANNRTCENGRSLDFNTNNKSHNNPNNDNRYP
ATSNINKHDTDISGNNQKKYSIDDFQLIRTLGTGSFGRVFLSKHKEDNSIYAIKRLKKSV
VIRQKQVDHITNEKAILSRIKHPFLVRMFGTFKDDRYLYIMMEFVIGGEFFTYLRRCRHF
DNETSRFYAAQVVLMFEYLHGKNIIYRDLKPENILIDKDGYLKLTDFGFAKAIEYRTFTL
CGTPEYIAPEVLLNKGHGKPVDWWTLGILIYEMVVGFPPFYDDEPMGIYQKILAGKIFFP
KYFDKNCKSLVKRLLTPDLTKRYGNLKGGVSDIKLHKWFYNYDFNSLISRKVDPPYIPKV
NSYDDSSNFEEYPDSHEQPTTVTGNADPFVDW
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggatggaatttggaaaagacttgtttctggagggaagaatcactcctcaaaagagggc
ggcaatagtcagaaaaatgcagttgctgctaacaatcggacatgtgaaaatggccgaagt
ttagattttaataccaataataagtcccacaataatccaaataatgacaaccgttatcct
gctacttcaaacatcaacaagcatgacacggatatatcggggaataaccagaaaaaatat
agcatcgacgattttcagcttattagaacattaggaacaggctcgttcggaagagttttc
ttatctaagcacaaggaagataatagcatttatgcaataaaaagacttaaaaaaagtgtg
gttattcggcaaaagcaggtggaccatattacaaatgaaaaagcgattctttcaagaatt
aaacatccatttttagttagaatgtttggaacatttaaagatgaccgatatttatacatt
atgatggaatttgttatagggggagagtttttcacatacctaagaaggtgtaggcacttt
gacaatgaaacttcaaggttttatgctgcgcaagttgtgttaatgtttgaatatttgcac
ggaaaaaacattatatatagagatcttaaaccagaaaatattctaattgacaaagatggg
tatttgaagctaactgattttggatttgcaaaggcaatcgaatataggacgtttacactt
tgtgggacgcctgaatatatcgctccagaagttcttttaaacaagggccatggaaagccg
gttgattggtggacgctgggcatattgatatatgaaatggttgtaggcttcccccctttt
tatgatgatgaacctatgggtatctatcaaaaaattctagcgggtaagatttttttccct
aagtattttgacaaaaattgtaaaagtttggtgaaaagactgcttactccggatttaaca
aaaagatatggtaaccttaaaggcggtgttagtgatataaaactacataagtggttttat
aattatgactttaattctttgatatcaaggaaagttgaccccccgtatattcctaaggtc
aactcgtatgatgattcatcgaattttgaagaatatccagatagccatgaacaacctact
actgttacaggtaatgctgatccattcgttgactggtag

DBGET integrated database retrieval system