KEGG   Cryptosporidium hominis: Chro.30344Help
Entry
Chro.30344        CDS       T00210                                 

Definition
protein kinase, cAMP-dependent, catalytic chain (EC:2.7.1.37)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cho  Cryptosporidium hominis
Brite
Enzymes [BR:cho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Chro.30344
Protein kinases [BR:cho01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Chro.30344
Messenger RNA biogenesis [BR:cho03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Chro.30344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 392 aa AA seqDB search
MDGIWKRLVSGGKNHSSKEGGNSQKNAVAANNRTCENGRSLDFNTNNKSHNNPNNDNRYP
ATSNINKHDTDISGNNQKKYSIDDFQLIRTLGTGSFGRVFLSKHKEDNSIYAIKRLKKSV
VIRQKQVDHITNEKAILSRIKHPFLVRMFGTFKDDRYLYIMMEFVIGGEFFTYLRRCRHF
DNETSRFYAAQVVLMFEYLHGKNIIYRDLKPENILIDKDGYLKLTDFGFAKAIEYRTFTL
CGTPEYIAPEVLLNKGHGKPVDWWTLGILIYEMVVGFPPFYDDEPMGIYQKILAGKIFFP
KYFDKNCKSLVKRLLTPDLTKRYGNLKGGVSDIKLHKWFYNYDFNSLISRKVDPPYIPKV
NSYDDSSNFEEYPDSHEQPTTVTGNADPFVDW
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggatggaatttggaaaagacttgtttctggagggaagaatcactcctcaaaagagggc
ggcaatagtcagaaaaatgcagttgctgctaacaatcggacatgtgaaaatggccgaagt
ttagattttaataccaataataagtcccacaataatccaaataatgacaaccgttatcct
gctacttcaaacatcaacaagcatgacacggatatatcggggaataaccagaaaaaatat
agcatcgacgattttcagcttattagaacattaggaacaggctcgttcggaagagttttc
ttatctaagcacaaggaagataatagcatttatgcaataaaaagacttaaaaaaagtgtg
gttattcggcaaaagcaggtggaccatattacaaatgaaaaagcgattctttcaagaatt
aaacatccatttttagttagaatgtttggaacatttaaagatgaccgatatttatacatt
atgatggaatttgttatagggggagagtttttcacatacctaagaaggtgtaggcacttt
gacaatgaaacttcaaggttttatgctgcgcaagttgtgttaatgtttgaatatttgcac
ggaaaaaacattatatatagagatcttaaaccagaaaatattctaattgacaaagatggg
tatttgaagctaactgattttggatttgcaaaggcaatcgaatataggacgtttacactt
tgtgggacgcctgaatatatcgctccagaagttcttttaaacaagggccatggaaagccg
gttgattggtggacgctgggcatattgatatatgaaatggttgtaggcttcccccctttt
tatgatgatgaacctatgggtatctatcaaaaaattctagcgggtaagatttttttccct
aagtattttgacaaaaattgtaaaagtttggtgaaaagactgcttactccggatttaaca
aaaagatatggtaaccttaaaggcggtgttagtgatataaaactacataagtggttttat
aattatgactttaattctttgatatcaaggaaagttgaccccccgtatattcctaaggtc
aactcgtatgatgattcatcgaattttgaagaatatccagatagccatgaacaacctact
actgttacaggtaatgctgatccattcgttgactggtag

DBGET integrated database retrieval system