KEGG   Cryptosporidium hominis: Chro.30361Help
Entry
Chro.30361        CDS       T00210                                 

Definition
histone acetyltransferase
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cho  Cryptosporidium hominis
Brite
Enzymes [BR:cho01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Chro.30361
Transcription machinery [BR:cho03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Chro.30361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 655 aa AA seqDB search
MFIEEANASIDRGIRTIIFEEFSPLVVENINKDYLEEIYRDYSDPKLLKLCNNSGFVEFL
KLSNEQGDLNNELIRIFKVTLEEIFSAVLSIINIQQWLSIEARERGPFPTIKKDERATVK
SFVMNYLPDENYENNYNSWKLFLKRDSPAGRKVCEMFKLSFLKSLLLTNIGVILNDIETS
GIFTKFALKSNLSKAICMKFAIKLCIACGIASKESIDHLKRQAWDHLRYISDDETLQSSL
LSETGLGFLHRDSGSAKEEALGIISFECITNDREPEHLVKLIALKNVFARQLPKMPREYI
VRLIFDRNHYSFCLLKKGKVIGGVCFRPYFEQRFAEIAFLAVTSTEQVKGYGTRLMNHLK
QHVKKSKIEYFLTYADNFATGYFRKQGFRKEVSMPKERWFGYIKDYDGGTLMECYINPEI
NYLRLSDLFHEQKSALLRAINTIRPLKVYPGINLWENGDESMVKKDLNSELTRNQKNIES
TISEPMNDGDPAKNFQNDPCAEDFTPIIDTKPENDLNINTKKIKPSDIPGVLEVGWVEKI
IDPVEQSKVDLSMNDQIWQLLDTLSRHENAWPFRKPVSIGEASDYYEIIKEPTDIQTMKR
KAKNKEYKTLSEFSSELKRMFDNCRFYNAKNTIYTKYANQLEAFIWPMLQTIQES
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgaagaggcaaatgccagcattgatagggggatccgcacaattatcttcgaa
gaattttcgcccttagtcgtagaaaatattaacaaggactacttggaagaaatatataga
gattactctgatccaaaattattaaaattatgtaataactctggttttgttgaattcctg
aagttatccaacgaacaaggggatttaaataatgaattaatccgaatttttaaggtaact
ttggaggagatattttcagcagtactttctattattaatatacaacaatggctcagtatt
gaagctcgcgaacggggtccatttccaactattaaaaaagatgaaagagcaactgtaaag
agctttgttatgaactatttgcctgatgaaaattatgaaaataactacaattcttggaag
ctgtttctcaagagagattctcctgcaggtagaaaagtctgtgaaatgtttaaactttca
tttttaaaatccttattgcttacaaatattggagtaattcttaatgatattgaaacttcg
ggaatatttactaaatttgcgttaaaaagcaacttaagtaaggctatttgcatgaagttt
gctattaaattatgcatagcatgtggtatcgcttccaaggaatctattgatcatttgaaa
aggcaagcatgggaccatctgaggtatatttctgatgatgaaactcttcagtccagtcta
ttgtctgaaactggattaggctttcttcatagagatagtggtagtgcaaaggaagaagct
ctgggtattatttcatttgaatgtattaccaatgacagagagccagaacatcttgttaaa
cttattgcattaaaaaatgttttcgcaaggcaattaccgaaaatgccaagagaatatata
gttagactgatttttgacagaaaccattattctttctgtttgctgaaaaaaggaaaagta
atcggtggagtatgttttcgcccgtacttcgagcaaagatttgctgaaattgcgttttta
gctgtaactagtacagagcaggttaaaggttatggtacaagattaatgaatcatttaaag
cagcatgtcaagaaaagcaaaatagaatactttttaacgtatgcagataactttgccacg
ggttatttcagaaaacaaggtttcagaaaagaggttagtatgccaaaagaaagatggttt
ggatatattaaagattatgacggcggtactttaatggagtgttatattaatccagagatt
aattatttgagattatctgatcttttccatgagcaaaaatctgcattattaagggctatt
aatactattagacctttaaaggtttatccaggtatcaatttatgggaaaatggagacgaa
agtatggtcaaaaaagatttaaatagtgagttaactaggaatcaaaaaaatattgaatca
actatatctgaaccaatgaatgatggtgatccagctaaaaatttccaaaatgacccttgt
gctgaagattttactccaattatagatactaaaccagagaatgatttaaacataaacaca
aaaaaaattaagcccagtgatatacctggtgttttagaggttggttgggtagaaaagata
attgatcctgtcgagcaatctaaggtcgacctctctatgaacgatcaaatttggcagtta
cttgataccctatcaaggcatgaaaatgcatggccgtttagaaaaccagttagcataggg
gaagcatcggactactatgagattattaaagaacctactgatatccaaactatgaagcgt
aaagctaaaaataaagaatataagacattatctgagtttagcagcgagcttaaaagaatg
tttgataactgcagattttacaatgcaaaaaatacaatttatacgaagtatgcaaaccag
ttggaggcatttatttggccaatgctacaaacgatacaggaatcataa

DBGET integrated database retrieval system