KEGG   Cryptosporidium hominis: Chro.40288Help
Entry
Chro.40288        CDS       T00210                                 

Definition
phospholipase C, delta
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cho  Cryptosporidium hominis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cho00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:cho04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 882 aa AA seqDB search
MFRPLLDCNGEISINRLLGSQDLSEYVISVRTFEDVVNKLNIVVSERLMQLLHEVDVDIA
LDTCKSGSYLYKYPRSCIGSRRFSRYNFEIDLDSGCVKWYKKKTLICSRKVVFIQTLYLN
DVNHILPGSDSDFWRSKKCTKKEYINSNFGIELVVIGKRNKTLRLLCANKEEWKFWMVGL
LVSHALAQREKLVSKIKGTKKIVDAKHFYTHDYIRRQWELSDLDNSGSISFSELMRLTKR
LQMPVSKDYTHALFCEYDNDNNGALDYKEFRNLLTQLLILPELRDLFDEYKDPDTNVMSA
NKFRNFLIDVQGMDPSNSLESLVNAVLNMKEPFIERGGITEIGFNILMSSEFNSAFDPLK
RDVYQSMDEPISHYWIASSHNTYLTGDQLTSKSEIGQYITVLLQGCRCVELDVWNGPDGL
PIIYHGHTLTSKVYFEDVIRACKDYAFQISPYPIILSLEMHASDKQREKVAEIILNVLGD
SLYIPPNDGSDRLPTPNELKYKFLVKAKVPKEDISFDLRAGVINEDNEKNDLNPDILEID
LEMSNNTGIKNEKQALSYNQNQTKRRLYSSLISLPGNAIQLSNFENRRRMSIGSLVETKF
LRFAKDSSMSLAKFHQDHLCRVYPSGTRISSSNYNPLIPWSYGAQIVALNYQAVGTALLL
NEGRFRQNGGSKSGYVLKPKMCLKKCFDGRVFDPMNPLETLELFDIPPVRVCIQILSAHQ
LPDNLSQFSRGIAGLISGNKLSPYITISVFGGPSEEFKSYRTPVINNNGFNPKWENLSPF
TFNVLCPEISIINFEVKSSDSIQSEFIAAASIPVSCLRPGLRWIQLFDANFIDIQCCGIL
ANISITTELPKTYVLSSILTGNNGSSSTNLQETLQQFRGIKF
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgtttcggccgttgttagattgtaatggagaaattagcattaatagattgctcggaagt
caagatctatccgaatatgtaatatccgttcgcacatttgaggatgtagtaaacaaattg
aatatagttgtaagtgaaagactcatgcaattgcttcatgaagttgatgtagatattgca
ctagatacatgcaaaagtggttcttacctatataaatatccgcgttcttgtattggtagt
agacgcttttcaagatataactttgaaattgacctagattctggatgcgtaaagtggtat
aaaaaaaaaactttaatttgttctagaaaagtggtatttattcagactttatatctaaat
gatgtaaaccacattcttccaggatctgatagtgacttttggaggtcaaagaaatgtaca
aagaaggagtatatcaattctaattttgggattgaactagtagtaataggaaaaagaaat
aaaacactaagacttttatgcgcaaataaagaagaatggaaattttggatggtcgggcta
ttagtaagtcatgctcttgctcaaagagagaaattagtttcaaaaattaaaggaacaaaa
aaaattgttgatgctaaacatttttacactcacgactacatcaggcgtcaatgggaactt
tcagatttagataactctggttcaataagcttctcagagttaatgcgtttaacaaagaga
ttgcagatgccagtatctaaagattatactcacgctctcttttgtgaatatgataatgat
aataatggtgcacttgattataaggaatttagaaatttgttaactcagcttttaatactc
cctgagttgcgtgatttatttgatgaatataaggatccagatacaaatgttatgagtgcg
aataaatttcgtaattttctgatagatgttcaaggaatggatccgtcaaactcattagaa
tcactagttaatgctgtattaaatatgaaagaaccgtttattgaaaggggtggtattact
gaaattgggttcaatattctaatgtcttcagaatttaactccgcatttgatccattaaaa
agagatgtatatcaatcaatggatgaacctatttcacactactggatagcttcgagccac
aatacatatttaactggcgaccaactaacttcaaaatccgagattggacaatatataact
gtattacttcaaggatgtagatgcgtagagttggatgtttggaatggcccagatggatta
ccaattatttaccatggccacactttaacatctaaggtttactttgaagatgtaattcga
gcatgcaaagactatgctttccagatatctccatatccgattattttatcacttgaaatg
catgcatctgataaacaacgtgaaaaggttgcggaaataatattgaacgtattaggcgat
tctctttatattcccccaaatgatgggagtgatagacttcccaccccaaatgaacttaag
tataaatttcttgtcaaagctaaggtcccaaaagaagatattagttttgatttaagagca
ggggttattaatgaagataatgaaaaaaatgatctaaacccagacatattagaaattgac
cttgaaatgtccaataatacagggattaaaaatgaaaagcaagccttgtcttacaatcaa
aatcagactaagaggagattatattctagtctaatttcccttccaggaaatgcgatacaa
ctgtccaattttgaaaatcgaagaagaatgagcattggttctcttgttgaaacaaaattt
ctgcgctttgcgaaagactcaagtatgagccttgcaaagttccatcaagatcatctatgt
agagtttatccatcaggtacacgtatatcgagttcaaactataatcctttaataccatgg
tcatacggagctcagattgtcgcattgaattaccaagcagttggaactgctttattattg
aatgaagggagattcagacaaaatggtggctcaaaaagtggctacgtattaaaaccaaaa
atgtgcctaaaaaagtgctttgatggacgggtattcgatcctatgaaccctttagaaact
ttagagctctttgatatccctcctgttagagtgtgtatccaaatattatcagctcaccag
ctccctgacaatctatcgcagttctcacgtggaattgcaggcctaatatctgggaataaa
ctttcaccatacattactatttctgtttttggagggcccagcgaagagttcaagtcatac
agaacgcctgtaataaataataatgggtttaatccaaaatgggaaaacttgtctccattt
acattcaatgttctttgcccagaaatttcgattattaatttcgaggttaagtcatcagat
tcgatacagtctgaatttattgcagcagcttcaattcctgtttcatgccttagacctggt
ttaaggtggatacaactatttgatgcaaattttattgatatccagtgttgtgggatcctt
gcgaatatttctataacaacagaattaccaaaaacatatgtgttgtcatcaattttaacg
ggaaacaatggaagttcatcaacaaatctacaagaaacattgcaacagtttagaggaatt
aaattttga

DBGET integrated database retrieval system