KEGG   Cryptosporidium hominis: Chro.40288Help
Entry
Chro.40288        CDS       T00210                                 

Definition
phospholipase C, delta
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cho  Cryptosporidium hominis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cho00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Chro.40288
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Chro.40288
Enzymes [BR:cho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Chro.40288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 882 aa AA seqDB search
MFRPLLDCNGEISINRLLGSQDLSEYVISVRTFEDVVNKLNIVVSERLMQLLHEVDVDIA
LDTCKSGSYLYKYPRSCIGSRRFSRYNFEIDLDSGCVKWYKKKTLICSRKVVFIQTLYLN
DVNHILPGSDSDFWRSKKCTKKEYINSNFGIELVVIGKRNKTLRLLCANKEEWKFWMVGL
LVSHALAQREKLVSKIKGTKKIVDAKHFYTHDYIRRQWELSDLDNSGSISFSELMRLTKR
LQMPVSKDYTHALFCEYDNDNNGALDYKEFRNLLTQLLILPELRDLFDEYKDPDTNVMSA
NKFRNFLIDVQGMDPSNSLESLVNAVLNMKEPFIERGGITEIGFNILMSSEFNSAFDPLK
RDVYQSMDEPISHYWIASSHNTYLTGDQLTSKSEIGQYITVLLQGCRCVELDVWNGPDGL
PIIYHGHTLTSKVYFEDVIRACKDYAFQISPYPIILSLEMHASDKQREKVAEIILNVLGD
SLYIPPNDGSDRLPTPNELKYKFLVKAKVPKEDISFDLRAGVINEDNEKNDLNPDILEID
LEMSNNTGIKNEKQALSYNQNQTKRRLYSSLISLPGNAIQLSNFENRRRMSIGSLVETKF
LRFAKDSSMSLAKFHQDHLCRVYPSGTRISSSNYNPLIPWSYGAQIVALNYQAVGTALLL
NEGRFRQNGGSKSGYVLKPKMCLKKCFDGRVFDPMNPLETLELFDIPPVRVCIQILSAHQ
LPDNLSQFSRGIAGLISGNKLSPYITISVFGGPSEEFKSYRTPVINNNGFNPKWENLSPF
TFNVLCPEISIINFEVKSSDSIQSEFIAAASIPVSCLRPGLRWIQLFDANFIDIQCCGIL
ANISITTELPKTYVLSSILTGNNGSSSTNLQETLQQFRGIKF
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgtttcggccgttgttagattgtaatggagaaattagcattaatagattgctcggaagt
caagatctatccgaatatgtaatatccgttcgcacatttgaggatgtagtaaacaaattg
aatatagttgtaagtgaaagactcatgcaattgcttcatgaagttgatgtagatattgca
ctagatacatgcaaaagtggttcttacctatataaatatccgcgttcttgtattggtagt
agacgcttttcaagatataactttgaaattgacctagattctggatgcgtaaagtggtat
aaaaaaaaaactttaatttgttctagaaaagtggtatttattcagactttatatctaaat
gatgtaaaccacattcttccaggatctgatagtgacttttggaggtcaaagaaatgtaca
aagaaggagtatatcaattctaattttgggattgaactagtagtaataggaaaaagaaat
aaaacactaagacttttatgcgcaaataaagaagaatggaaattttggatggtcgggcta
ttagtaagtcatgctcttgctcaaagagagaaattagtttcaaaaattaaaggaacaaaa
aaaattgttgatgctaaacatttttacactcacgactacatcaggcgtcaatgggaactt
tcagatttagataactctggttcaataagcttctcagagttaatgcgtttaacaaagaga
ttgcagatgccagtatctaaagattatactcacgctctcttttgtgaatatgataatgat
aataatggtgcacttgattataaggaatttagaaatttgttaactcagcttttaatactc
cctgagttgcgtgatttatttgatgaatataaggatccagatacaaatgttatgagtgcg
aataaatttcgtaattttctgatagatgttcaaggaatggatccgtcaaactcattagaa
tcactagttaatgctgtattaaatatgaaagaaccgtttattgaaaggggtggtattact
gaaattgggttcaatattctaatgtcttcagaatttaactccgcatttgatccattaaaa
agagatgtatatcaatcaatggatgaacctatttcacactactggatagcttcgagccac
aatacatatttaactggcgaccaactaacttcaaaatccgagattggacaatatataact
gtattacttcaaggatgtagatgcgtagagttggatgtttggaatggcccagatggatta
ccaattatttaccatggccacactttaacatctaaggtttactttgaagatgtaattcga
gcatgcaaagactatgctttccagatatctccatatccgattattttatcacttgaaatg
catgcatctgataaacaacgtgaaaaggttgcggaaataatattgaacgtattaggcgat
tctctttatattcccccaaatgatgggagtgatagacttcccaccccaaatgaacttaag
tataaatttcttgtcaaagctaaggtcccaaaagaagatattagttttgatttaagagca
ggggttattaatgaagataatgaaaaaaatgatctaaacccagacatattagaaattgac
cttgaaatgtccaataatacagggattaaaaatgaaaagcaagccttgtcttacaatcaa
aatcagactaagaggagattatattctagtctaatttcccttccaggaaatgcgatacaa
ctgtccaattttgaaaatcgaagaagaatgagcattggttctcttgttgaaacaaaattt
ctgcgctttgcgaaagactcaagtatgagccttgcaaagttccatcaagatcatctatgt
agagtttatccatcaggtacacgtatatcgagttcaaactataatcctttaataccatgg
tcatacggagctcagattgtcgcattgaattaccaagcagttggaactgctttattattg
aatgaagggagattcagacaaaatggtggctcaaaaagtggctacgtattaaaaccaaaa
atgtgcctaaaaaagtgctttgatggacgggtattcgatcctatgaaccctttagaaact
ttagagctctttgatatccctcctgttagagtgtgtatccaaatattatcagctcaccag
ctccctgacaatctatcgcagttctcacgtggaattgcaggcctaatatctgggaataaa
ctttcaccatacattactatttctgtttttggagggcccagcgaagagttcaagtcatac
agaacgcctgtaataaataataatgggtttaatccaaaatgggaaaacttgtctccattt
acattcaatgttctttgcccagaaatttcgattattaatttcgaggttaagtcatcagat
tcgatacagtctgaatttattgcagcagcttcaattcctgtttcatgccttagacctggt
ttaaggtggatacaactatttgatgcaaattttattgatatccagtgttgtgggatcctt
gcgaatatttctataacaacagaattaccaaaaacatatgtgttgtcatcaattttaacg
ggaaacaatggaagttcatcaacaaatctacaagaaacattgcaacagtttagaggaatt
aaattttga

DBGET integrated database retrieval system